Recombinant Marchantia polymorpha Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Recombinant Production in Marchantia polymorpha

Transformation methods:

  • Biolistic chloroplast transformation: Plasmid DNA coated onto DNAdel nanoparticles is delivered into chloroplasts via particle bombardment of spores .

  • Homologous recombination: The aadA spectinomycin resistance cassette replaces or disrupts the ycf10 locus for selection .

Promoter systems:

PromoterExpression LevelLocalizationGrowth ImpactSource
psbA (core)LowChloroplastNeutral
35S ×2HighCytosol/ChloroplastInhibitory
MpERF1ModerateUbiquitousNeutral

Subcellular targeting:

  • Cytosolic expression yields higher recombinant protein levels without growth penalties .

  • Chloroplast targeting requires transit peptides (e.g., psbA 5′UTR) but achieves organelle-specific activity .

Functional Insights from Disruption Studies

Key findings:

  • CO₂ uptake: ycf10 disruption reduces CO₂/HCO₃⁻ affinity by 40–60% in Chlamydomonas reinhardtii, implicating cemA in Ci transport .

  • Light sensitivity: Mutants exhibit impaired photoautotrophic growth under high light due to inefficient energy dissipation .

Mechanistic role:

  • Facilitates proton-coupled Ci transport across the chloroplast envelope .

  • Interacts with photosynthetic components to optimize carbon assimilation .

Applications in Synthetic Biology

Metabolic engineering:

  • Used to study chloroplast Ci dynamics for improving C₃/C₄ pathway efficiency .

  • Co-expressed with RUBY betalain biosynthesis cassettes for real-time metabolic monitoring .

Tool development:

  • Serves as a testbed for chloroplast promoter optimization (e.g., psbA, rbcL) in bryophytes .

  • Enables high-resolution imaging of chloroplast envelope dynamics via fusion with fluorescent tags .

Challenges and Future Directions

  • Expression bottlenecks: High-level cytosolic expression (e.g., 35S ×2 promoter) causes growth inhibition, necessitating inducible systems .

  • Evolutionary studies: Comparative analysis of cemA homologs in Marchantia vs. angiosperms could clarify land plant adaptation to atmospheric CO₂ changes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
cemA
Target Protein Sequence
MKKNFSYWRIFHHIFALPYCSLEKAYKASKRIQKIKKDYFLYKNILFSSKRSWQSILFYI DTELNNSVFKIYLSLLEYKLSLWLIQLFLIFSLFFKKNSKFDLILPNINEKKKKRKINRK LAWIRATLNDLESWRRYYLFSSFLSLDKKEKNNFSFLQMKSSRLTAIAYESIGLVPRSIT RTFSRFKAELTNQSSSLVLKEFRLAKYQALASLQYIGCLFFIPLGVSFFFQKCFLEPWIQ NWWNIYQSQIFLTSFQEEKALKKLQEIEELFWLDKVMTYSSNKIQLQDLTKEIHQQTIEL VQIYNNDSIKIVLHLLTDLIWFITLSCLFILGKERLVILNSWAQELFYSLSDTMKAFFIL LLTDLCIGFHSPHGWEIVISSCLEHFGFVHNKHVISCFVSTFPVILDTVFKYLIFRHLNR ISPSIVATYHTMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What makes Marchantia polymorpha a suitable model organism for chloroplast membrane protein studies?

Marchantia polymorpha has emerged as an excellent model organism for studying chloroplast membrane proteins for several key reasons:

  • As a liverwort, it occupies a basal position in land plant evolution, making it valuable for comparative studies across plant lineages

  • It possesses a haploid-dominant life cycle that facilitates genetic analyses

  • Its genome has been fully sequenced and assembled into chromosome-scale pseudomolecules (88% of the genome anchored to a high-density linkage map)

  • Multiple transformation protocols have been established for M. polymorpha with high efficiency (up to 97% using improved AgarTrap methods)

  • The absence of RNA editing mechanisms in M. polymorpha chloroplasts simplifies the study of gene expression

  • Its chloroplast genome structure is well-conserved when compared to angiosperms, containing 123 annotated genes primarily involved in photosynthesis, electron transport, transcription, and translation

For specific chloroplast envelope studies, M. polymorpha provides a simpler system than angiosperms while maintaining the fundamental chloroplast architecture, making it ideal for addressing evolutionary questions related to chloroplast membrane proteins.

What is the general structure and function of the chloroplast envelope in land plants?

The chloroplast envelope consists of a two-membrane system that surrounds plastids and plays critical roles in plant metabolism:

  • Structure: The envelope is composed of an outer and inner membrane, each with distinct protein composition and functions

  • Transport functions: Due to the integration of chloroplast metabolism within the plant cell, the envelope serves as the site of many specific transport activities

  • Protein composition: Proteomic analysis has identified numerous integral membrane proteins in the chloroplast envelope, with most containing multiple α-helical transmembrane regions

Key characteristics of chloroplast envelope proteins:

  • Proteins located in the inner membrane typically have at least four transmembrane α-helices

  • Inner membrane transporters often exhibit both low residue-to-transmembrane domain ratios (<100) and high isoelectric points (pI >8.8)

  • Most transport functions are localized to the inner envelope membrane, with highly hydrophobic proteins serving as transporters

This distinct biochemical signature allows researchers to identify potential envelope transporters from genomic data with reasonable accuracy, as demonstrated in both Arabidopsis and Marchantia.

What are the most effective transformation methods for expressing recombinant proteins in M. polymorpha chloroplasts?

Several highly efficient transformation methods have been developed for M. polymorpha, each with specific advantages:

AgarTrap Method (Highly Recommended)

The AgarTrap (agar-utilized transformation with pouring solutions) method has been optimized specifically for M. polymorpha with exceptional efficiency:

  • Efficiency: Up to 97% transformation efficiency with optimized protocols

  • Methodology: Involves culturing liverwort tissue with various solutions on a single solid medium

  • Advantages: Simple procedure requiring minimal expertise, cost, and time

  • Critical factors: Four key factors influence transformation efficiency:

    • Humidity conditions

    • Surfactant concentration in transformation buffer

    • Agrobacterium strain selection

    • Light/dark conditions during transformation

Chloroplast-Specific Transformation

For targeting the chloroplast genome directly:

  • Biolistic particle delivery (gene gun) has been successfully used for chloroplast transformation

  • Fluorescent reporters like mTurquoise2cp (codon-optimized for chloroplast expression) can be used for early screening of transplastomic events

  • Expression from the chloroplast genome can yield high protein levels (400-500 μg/g fresh weight, approximately 15% of total soluble protein)

What promoter systems work best for controlling recombinant protein expression in M. polymorpha?

Promoter selection is crucial for successful recombinant protein expression in M. polymorpha. The following promoters have been characterized and compared:

Constitutive Promoters

PromoterExpression LevelGrowth ImpactTissue SpecificityReference
pro35S×2 (CaMV)Highest protein yieldGrowth inhibition observedAll tissues
proMpERF1High expressionMinimal growth penaltyAll tissues
proMpHDZIntermediate levelsMinimal growth penaltyAll tissues
proMpEF1αModerate expressionMinimal impactBroad expression
proMpUBQModerate expressionMinimal impactThroughout gemmae

Tissue-Specific Promoters

  • proMpaTUB-like: Preferentially expressed in meristematic areas

  • proMpRbcS-like: Mainly detected in photosynthetic tissues, less in meristematic regions

Inducible Promoters

For controlled expression:

  • MpHSP17.8A1 promoter: Heat-shock inducible promoter with high induction and low basal activity

    • Can be induced globally in thalli under whole-plant heat treatment

    • Allows local induction using laser-assisted targeted heating

    • Useful for mitigating growth burdens associated with high recombinant protein accumulation

When expressing challenging proteins like membrane proteins, combining appropriate promoters with optimized subcellular targeting can significantly improve yields and reduce negative impacts on plant growth.

How can subcellular targeting be optimized to improve recombinant chloroplast envelope membrane protein yields?

Subcellular targeting strategies significantly impact recombinant protein yield and stability in M. polymorpha:

Comparative Analysis of Subcellular Compartments

Subcellular LocationRelative YieldGrowth ImpactNotesReference
CytosolHighestMinimalBest for high expression without growth burden
Chloroplast (genome)15% of TSPModerateUp to 400-500 μg/g FW
Plasma membraneVariableVariableSuccessful for membrane proteins
NucleusLowerMinimalUseful for transcription factors
ApoplastVariableMinimalCan be high in some systems

For chloroplast envelope membrane proteins specifically:

  • Post-translational targeting to chloroplasts can yield 0.1-11% of recombinant proteins

  • Dual-targeting strategies may improve incorporation into the chloroplast envelope

  • Transit peptide optimization: Using native M. polymorpha chloroplast transit peptides (such as from SIG2 Mp4g13380) improves targeting efficiency

Research has shown that targeting specificity can be crucial - for example, studies on phototropin (phot) demonstrated that only plasma membrane-associated phot could induce cold avoidance responses, while cytosolic phot could not . This suggests that proper membrane targeting is essential not just for protein yield but for functional activity.

What are the molecular characteristics and evolutionary significance of chloroplast envelope membrane proteins in bryophytes compared to vascular plants?

Comparative analysis between M. polymorpha and other plant species reveals important evolutionary insights about chloroplast envelope proteins:

Structural and Genomic Comparison

  • Chloroplast genome organization in M. polymorpha contains 123 annotated genes involved primarily in photosynthesis, electron transport, transcription, and translation

  • Limited genome collinearity exists between bryophyte genomes and vascular plants, suggesting extensive rearrangements since divergence

  • Despite genomic rearrangements, chloroplast envelope protein function appears conserved across land plants

Distinctive Properties of Bryophyte Chloroplast Envelopes

  • DNA methylation patterns: In M. polymorpha and P. patens, DNA methylation is spread evenly along chromosomes, contrasting with angiosperms like Arabidopsis where methylation is enriched at centromeres

  • Centromere structure: Bryophyte centromeres are marked by high abundance of retroelements, unlike in vascular plants

  • Recombination rates: M. polymorpha shows highest recombination in the middle of chromosome arms (similar to vascular plants), while P. patens has evenly distributed recombination rates along chromosomes

Proteomic analysis shows chloroplast envelope proteins in bryophytes share physicochemical properties with their counterparts in higher plants:

  • Inner membrane transporters typically have 4+ transmembrane domains

  • Low residue/transmembrane domain ratios (<100)

  • High isoelectric points (pI >8.8)

These conserved properties suggest fundamental roles established early in land plant evolution.

What protocols are most effective for isolating and characterizing chloroplast envelope membrane proteins from M. polymorpha?

Isolating and characterizing chloroplast envelope membrane proteins requires specialized techniques due to their hydrophobicity and often low abundance:

Isolation Protocol

  • Preparation of highly purified chloroplast fractions:

    • Isolate intact chloroplasts from M. polymorpha thalli using Percoll gradient centrifugation

    • Ensure purity by microscopic examination and marker enzyme assays to verify absence of contamination from other organelles

  • Envelope membrane isolation:

    • Lyse purified chloroplasts in hypotonic buffer

    • Separate envelope membranes from thylakoids and stromal components by sucrose gradient ultracentrifugation

    • Further purify envelope fractions using two-phase partitioning if needed

  • Extraction of hydrophobic proteins:

    • Extract membrane proteins using organic solvents (chloroform/methanol)

    • This extraction enriches for highly hydrophobic proteins that are often under-represented in conventional protein preparations

Characterization Methods

  • Proteomic analysis:

    • SDS-PAGE separation followed by tandem mass spectrometry (MS/MS)

    • Use specialized search algorithms for identifying hydrophobic proteins (BLAST-based programs customized for membrane proteins)

  • Validation of subcellular location:

    • Immunodetection in isolated subcellular fractions

    • For minor proteins, compare detection in chloroplast extract, stroma, thylakoid and envelope subfractions

    • Further verification by determining inner or outer envelope localization

  • Structural analysis:

    • Prediction of transmembrane domains using specialized algorithms

    • Calculation of physicochemical properties (pI, residues/transmembrane domain)

Using this approach, researchers have successfully identified numerous envelope proteins, including those present at very low abundance (as low as 1:100,000th of total cellular proteins) .

How can I design gene constructs for improved expression and targeting of recombinant chloroplast envelope membrane proteins?

Designing effective gene constructs for chloroplast envelope membrane proteins requires careful consideration of several factors:

Codon Optimization Strategies

  • Nuclear genome expression:

    • Optimize codons for M. polymorpha nuclear genome expression

    • Remove rare codons while maintaining GC content appropriate for M. polymorpha

    • Consider using the "MarpoDB" database, which serves as an open registry for M. polymorpha genetic parts

  • Chloroplast genome expression:

    • For transplastomic approaches, optimize codons specifically for chloroplast expression

    • Example: mTurquoise2cp was successfully designed as a codon-optimized gfp variant for expression from the M. polymorpha chloroplast genome

Critical Construct Elements

  • Promoter selection:

    • For constitutive expression: proMpERF1 or proMpHDZ (high expression with minimal growth impact)

    • For inducible expression: MpHSP17.8A1 heat-shock promoter

    • For chloroplast transformation: identified promoters from transcriptome analysis of highly transcribed regions

  • Transit peptide options:

    • For chloroplast targeting: Mp SIG2 (Mp4g13380) signal peptide

    • For membrane targeting: Consider using the targeting sequence from a native M. polymorpha membrane protein

  • Protein tags and reporters:

    • Fluorescent protein tags: mTurquoise2 works well for nuclear expression

    • For chloroplast expression: mTurquoise2cp (codon-optimized version)

    • Consider C-terminal tags to avoid interfering with transit peptide function

  • Gateway-compatible vectors:

    • Several Gateway technology-based binary vectors have been developed specifically for M. polymorpha

    • pMpGWB series vectors offer various selection markers including hygromycin, chlorsulfuron, and sulfadiazine resistance

How can I optimize transformation protocols when working with difficult-to-express membrane proteins?

Membrane proteins pose specific challenges for recombinant expression. Here are optimization strategies for M. polymorpha:

Critical Parameters for Transformation

  • Selection marker choice:

    • Multiple selection systems are available: hygromycin, chlorsulfuron, and sulfadiazine

    • These can be combined for transgene stacking experiments

    • Recent research shows sulfadiazine selection works with comparable efficiency to hygromycin

  • Agrobacterium strain selection:

    • Different Agrobacterium strains show varying transformation efficiencies

    • Strain selection is one of four key factors affecting AgarTrap transformation success

  • Transformation conditions:

    • Humidity control is critical for transformation efficiency

    • Surfactant concentration in transformation buffer affects results

    • Light/dark conditions during transformation influence success rates

Strategies for Difficult Membrane Proteins

  • Fusion with soluble domains:

    • Adding a soluble protein domain can improve folding and stability

    • Consider N- or C-terminal fusions with fluorescent proteins

  • Expression level modulation:

    • For toxic membrane proteins, use inducible promoters like MpHSP17.8A1

    • Consider the Cre/loxP-mediated site-specific recombination system for controlled expression

  • Co-expression with chaperones:

    • Co-express with molecular chaperones that facilitate membrane protein folding

    • Use polycistronic expression via P2A sequences, which has been demonstrated to work effectively in M. polymorpha

Troubleshooting Guide

ProblemPossible CauseSolution
Low transformation efficiencySuboptimal Agrobacterium strainTest different strains (e.g., GV3101, EHA105, AGL1)
Humidity issuesEnsure optimal humidity during transformation
Co-cultivation conditionsAdjust light/dark conditions during co-cultivation
Growth inhibitionHigh protein toxicitySwitch to inducible promoter systems
Metabolic burdenUse tissue-specific promoters to limit expression
Protein aggregationImproper foldingTry different subcellular targeting strategies
High expression levelsReduce expression level with weaker promoters
Poor protein detectionLow expressionUse codon-optimized sequences
Protein instabilityAdd stabilizing tags or domains

Researchers have successfully demonstrated that for expressing challenging enzymes or proteins, a polycistronic approach using P2A sequences for coordinated expression of multiple proteins can be highly effective in M. polymorpha .

What techniques can be used to analyze the function and interactions of recombinant chloroplast envelope membrane proteins in vivo?

Several advanced techniques can be employed to study chloroplast envelope membrane proteins in living M. polymorpha cells:

Microscopy-Based Approaches

  • Confocal microscopy for localization studies:

    • Successfully used to visualize subcellular protein localization in M. polymorpha

    • Enable tracking of protein movement between compartments

    • Example: Researchers visualized phototropin relocalization from plasma membrane to cytosol and chloroplast periphery using this technique

  • Multi-color imaging with fluorescent protein fusions:

    • Triple transgenic lines can be created to simultaneously visualize multiple cellular structures

    • Example: Lines expressing fluorescent proteins labeling the plasma membrane, cortical microtubules, and nucleus have been generated

  • Targeted heating techniques:

    • Laser-assisted targeted heating allows local induction of genes under heat-shock promoters

    • Enables spatially controlled expression within specific tissues or cells

Biochemical and Functional Analysis

  • In vivo transport assays:

    • Use fluorescent substrates to monitor transport activity

    • Compare wild-type and mutant protein function

  • Proteomics approaches:

    • Proximity labeling techniques to identify interacting proteins

    • Differential proteome analysis to identify envelope proteins critical for specific functions (e.g., cold acclimation)

  • Genetic analysis with CRISPR/Cas9:

    • Create knockout or knockdown mutants

    • Perform complementation studies with modified proteins

    • The haploid nature of M. polymorpha facilitates genetic analysis

  • Conditional gene expression/deletion systems:

    • The MpHSP17.8A1 promoter combined with Cre/loxP-mediated recombination allows for inducible gene deletion

    • This system can be employed for studying essential genes in the haploid M. polymorpha

Case Study: Phototropin Localization Analysis

Researchers investigating the cold-sensing mechanism in M. polymorpha employed an elegant approach to determine the importance of subcellular localization for protein function:

  • Generated variants of phototropin (phot) that localized specifically to either plasma membrane or cytosol

  • Used Agrobacterium-mediated gemma transformation to create stable transformants

  • Employed confocal microscopy to verify protein localization

  • Tested the function of each variant in cold-avoidance response

  • Determined that only plasma membrane-associated phot could function in cold sensing

This approach demonstrated the critical importance of proper membrane localization for protein function and could be adapted for studying chloroplast envelope membrane proteins.

How can I interpret proteomic data to identify novel chloroplast envelope membrane proteins?

Interpreting proteomic data for chloroplast envelope membrane proteins requires specific analytical approaches:

Data Analysis Pipeline

  • Enrichment analysis:

    • Compare protein abundance in whole chloroplast lysate versus enriched envelope fractions

    • Calculate enrichment factors to identify envelope-localized candidates

    • Proteins in envelope preparations but depleted in whole chloroplasts are potential contaminants

  • Transmembrane domain prediction:

    • Use specialized algorithms to predict α-helical transmembrane domains

    • Most envelope transporters contain at least 4 predicted transmembrane domains

  • Physicochemical property analysis:

    • Calculate residue/transmembrane domain ratio (Res/TM)

    • Determine isoelectric point (pI)

    • Inner membrane transporters typically have Res/TM < 100 and pI > 8.8

Decision Matrix for Envelope Protein Classification

Based on research by Ferro et al. (2002), the following matrix helps classify identified proteins:

LocationRes/TM RatiopITransmembrane Domains
Inner membrane transporters<100>8.8≥4
Outer membrane proteinsVariableVariableβ-barrel structure or fewer TMs
Peripheral proteinsHighVariable0-1

Case Study from Chloroplast Envelope Research

In a proteomic study of the chloroplast envelope:

  • 54 proteins were identified from 306 non-redundant peptide sequences

  • 27 were novel envelope proteins

  • Most contained multiple α-helical transmembrane regions

  • Analysis showed a correlation between subcellular location and combined values of pI and Res/TM

The study demonstrated that proteins from the inner membrane have both Res/TM < 100 and pI > 8.8, providing a signature for identifying potential inner envelope transporters .

Statistical Methods for Expression Analysis

  • Quantitative fluorescence microscopy:

    • Used successfully for analysis of promoter activity in M. polymorpha

    • Requires appropriate normalization to control for imaging conditions

    • Enables relative comparison of different promoters and constructs

  • Protein quantification methods:

    • Western blot with quantitative standards (15-20% variation typical)

    • ELISA for more precise quantification (5-10% variation)

    • Mass spectrometry-based absolute quantification using labeled standards

  • Statistical tests for comparisons:

    • ANOVA with post-hoc tests (Tukey's HSD) for comparing multiple constructs

    • For non-normally distributed data, use non-parametric tests (Kruskal-Wallis)

    • Effect size calculations using partial η² (0.01=small, 0.06=medium, 0.14=large)

Localization Analysis

  • Co-localization measurements:

    • Pearson's correlation coefficient for measuring association between two markers

    • Manders' overlap coefficient for quantifying co-localization

    • These methods have been successfully applied to M. polymorpha in multi-color imaging experiments

  • Validation approaches:

    • Subcellular fractionation followed by immunoblotting confirms localization observed by microscopy

    • Independent confirmation using biochemical assays for membrane association

Example Statistical Analysis from Literature

In a study evaluating the psychometric properties of a questionnaire, researchers employed:

  • Confirmatory factor analysis (CFA) to check construct validity

  • Omega coefficient (ω) instead of Cronbach's alpha for reliability assessment

    • Omega is more precise for non-continuous data

    • Provides greater stability in analysis

  • Multigroup CFA to analyze factorial invariance based on gender

  • MANOVA to analyze mean differences with effect size estimated using partial η²

These same statistical approaches can be adapted for analyzing expression and localization data for recombinant membrane proteins in M. polymorpha.

What are the emerging techniques that might revolutionize chloroplast envelope membrane protein research in M. polymorpha?

Several cutting-edge approaches show promise for advancing chloroplast envelope membrane protein research:

Emerging Technologies

  • CRISPR/Cas systems optimized for M. polymorpha:

    • Precise genome editing to create mutant libraries

    • Knock-in approaches for tagging endogenous proteins

    • CRISPRi/CRISPRa for modulating gene expression without permanent modification

  • Single-cell technologies:

    • Single-cell RNA-seq to analyze tissue-specific expression patterns

    • Single-cell proteomics approaches being developed may soon be applicable

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed localization studies

    • Correlative light and electron microscopy (CLEM) for ultrastructural context

    • Live-cell imaging with improved temporal resolution

  • Protein structure determination:

    • Cryo-EM for membrane protein structures without crystallization

    • AlphaFold and other AI approaches for structure prediction

    • Integrative structural biology combining multiple data types

Synthetic Biology Applications

  • Designer chloroplasts:

    • Engineering the chloroplast envelope for enhanced metabolite transport

    • Creating synthetic protein circuits within the chloroplast

    • M. polymorpha is positioned as an ideal test-bed for chloroplast engineering

  • Chloroplast hyperexpression systems:

    • Development of tools for protein hyperexpression in chloroplasts

    • Identification of RNA stabilization elements to enhance expression

    • Researchers have already mapped transcription in M. polymorpha chloroplasts and identified elements for high-level expression

  • Multi-protein complex assembly:

    • Polycistronic expression strategies for coordinated production of protein complexes

    • Demonstrated successfully with metabolic pathways like betalain synthesis

The intersection of these technologies with the genetic tractability of M. polymorpha positions this model organism at the forefront of chloroplast membrane biology research.

How might studies of chloroplast envelope membrane proteins in M. polymorpha inform our understanding of plant evolution?

As a basal land plant, M. polymorpha provides unique evolutionary insights through the study of its chloroplast envelope proteins:

Evolutionary Significance

  • Comparative genomics perspectives:

    • Genome structure in M. polymorpha differs from the model moss Physcomitrella patens

    • Limited genome collinearity between bryophyte genomes and vascular plants suggests extensive rearrangements since divergence

    • Despite genomic rearrangements, conservation of chloroplast envelope protein function across land plants

  • Conserved regulatory mechanisms:

    • cAMP signaling has been confirmed in basal land plants like M. polymorpha, demonstrating its ancient origin in plant lineages

    • The research identifies regulatory subunits of cAMP-dependent protein kinase that control sperm motility

  • Evolutionary adaptation of chloroplast function:

    • M. polymorpha represents an early stage in land plant evolution with distinctive adaptations

    • Study of chloroplast envelope proteins can reveal how transport systems evolved during the transition to land

Research Applications for Evolutionary Questions

  • Ancestral state reconstruction:

    • Comparing chloroplast envelope proteins across bryophytes, lycophytes, ferns, and seed plants

    • Identifying core components present in the common ancestor of land plants

  • Functional evolution experiments:

    • Expressing envelope proteins from diverse plant lineages in M. polymorpha

    • Testing whether ancient functions are maintained across evolutionary time

    • Identifying lineage-specific innovations in chloroplast envelope function

  • Molecular clock analyses:

    • Determining rates of sequence evolution in chloroplast envelope proteins

    • Correlating structural conservation with functional constraints

    • Identifying rapidly evolving regions that may represent adaptations to new environments

The study of chloroplast envelope membrane proteins in M. polymorpha thus provides a unique window into the early evolution of land plants and the adaptation of the photosynthetic apparatus to terrestrial environments.

What resources are available for researchers working with M. polymorpha and chloroplast envelope proteins?

Researchers have access to several valuable resources:

Genetic and Genomic Resources

  • MarpoDB: An open registry for M. polymorpha genetic parts

    • Contains promoter elements, coding sequences, and other genetic parts

    • Facilitates synthetic biology approaches

  • Genome databases:

    • Complete nuclear genome assembly with eight pseudomolecules

    • Chloroplast genome sequence (MH635409)

    • Comprehensive annotation of genes and regulatory elements

  • Vector collections:

    • pMpGWB series: Gateway-compatible vectors with various selection markers

    • pMpGWBs00 backbone: Vectors with sulfadiazine selection

    • Specialized vectors for chloroplast transformation

Methodological Resources

  • Transformation protocols:

    • Improved G-AgarTrap method with up to 97% efficiency

    • Biolistic transformation for chloroplast engineering

    • Detailed protocols for spore and thallus transformation

  • Expression systems:

    • Constitutive promoters with characterized expression levels

    • Inducible systems based on heat-shock promoters

    • Tissue-specific promoters for targeted expression

Community Resources

  • Stock centers:

    • Marchantia community maintains strain collections

    • Mutant libraries increasingly available

  • Protocols and methods papers:

    • Detailed methodological publications on transformation

    • Protocols for chloroplast isolation and envelope protein analysis

    • Comprehensive guides for genetic manipulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.