Recombinant Marchantia polymorpha Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Marchantia polymorpha Cytochrome b6-f Complex Subunit 4 (petD)

The cytochrome $$b_6f$$ complex is an essential component in the photosynthetic electron transport chain of plants, algae, and cyanobacteria . It mediates electron transfer between Photosystem II and Photosystem I, contributing to the generation of a proton gradient that drives ATP synthesis . In eukaryotes, the cytochrome $$b_6f$$ complex consists of multiple subunits, including cytochrome f, cytochrome $$b_6$$, the Rieske iron-sulfur protein, subunit IV (petD), and several smaller subunits .

Marchantia polymorpha is a liverwort that has emerged as a model organism for plant research . PetD encodes subunit IV of the cytochrome $$b_6f$$ complex in Marchantia polymorpha . The recombinant form of Marchantia polymorpha cytochrome $$b_6f$$ complex subunit 4 (petD) refers to the protein produced using recombinant DNA technology, allowing for detailed studies of its structure, function, and interactions within the complex.

Structure and Function of Cytochrome $$b_6f$$ Complex Subunit 4 (petD)

Cytochrome $$b_6f$$ complex subunit 4 (petD) is one of the four major subunits of the cytochrome $$b_6f$$ complex . The molecular weight of subunit IV is 17,444 Da .

PetD plays a crucial role in the assembly and stability of the cytochrome $$b_6f$$ complex . It is essential for electron transfer from PSII to PSI .

Research Findings and Significance

  • Essential Role in Photosynthesis The cytochrome $$b_6f$$ complex, including the PetD subunit, is vital for photosynthetic electron transport, which links Photosystem II (PSII) to Photosystem I (PSI) . This complex facilitates the transfer of electrons from reduced plastoquinone to plastocyanin or a $$c$$-type cytochrome in the thylakoid lumen, contributing to the proton gradient for ATP synthesis .

  • Impact on ATP Synthesis The electron transfer process via the cytochrome $$b_6f$$ complex is coupled with proton translocation from the stroma to the thylakoid lumen, which enhances ATP synthesis in chloroplasts .

  • Ycf6 Subunit Discovery Research indicates that the cytochrome $$b_6f$$ complex contains an additional subunit specified by the ycf6 reading frame . Mutants lacking ycf6 are deficient in functional cytochrome $$b_6f$$ complexes, highlighting the importance of this subunit in complex assembly or stability .

  • Structural Insights Analysis of conserved amino acid sequences in cytochrome $$b_6$$ and subunit IV has allowed for the re-evaluation of helix lengths and interface regions. These analyses have also identified surface-seeking helices and documented high sequence invariance compared to mitochondrial cytochromes, particularly in segments of cyt $$b_6$$ predicted to be extrinsic on the $$n$$-side of the membrane .

  • Knockout Studies Studies involving the targeted inactivation of ycf6 in tobacco chloroplasts have shown that the absence of this subunit leads to a complete absence of the cytochrome $$b_6f$$ complex, blocking electron transfer from PSII to PSI .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipments.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.

Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
petD
Target Protein Sequence
MGVTKKPDLSDPILRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPS MIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVALWLGIGAALPIDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.