Recombinant Marchantia polymorpha Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Electron Transport Chain

COX2 is a transmembrane subunit of Complex IV, forming a binuclear copper A center critical for electron transfer:

  1. Electron Transfer: Accepts electrons from cytochrome c via the copper A center.

  2. Catalytic Activity: Facilitates the reduction of O₂ to H₂O, generating a proton gradient for ATP synthesis.

  3. Subcellular Localization: Anchored to the mitochondrial inner membrane (IM) via multiple transmembrane helices .

Membrane Insertion and Chaperone Systems

COX2 biogenesis requires specialized chaperones:

  • OXA2b: A plant-specific mitochondrial membrane insertase with a tetratricopeptide repeat (TPR) domain. It directly binds the nascent COX2 C-terminus during translation, ensuring proper IM insertion. This function mirrors roles of Cox18 and Mss2 in yeast, making OXA2b indispensable for Complex IV assembly .

  • OXA2a: Indirectly supports COX2 biogenesis by aiding cytochrome c maturation, a prerequisite for Complex IV activity .

ChaperoneRole in COX2 Biogenesis
OXA2bDirect IM insertion of COX2
OXA2aCytochrome c maturation (indirect support)

Mitochondrial Genome Organization

Marchantia polymorpha’s mitochondrial genome retains ancestral features, including:

  • Gene Content: cox1, cox2, cox3 (Complex IV subunits) and cob (Complex III) .

  • Gene Transfer: Evidence of horizontal gene transfer (HGT) between mitochondrial and chloroplast genomes, though cox2 remains mitochondrially localized .

GeneFunctionGenomic Context
cox2Complex IV subunit IIMitochondrial genome
cox1Complex IV catalytic subunitMitochondrial genome
cobComplex III subunitMitochondrial genome

Experimental Uses

Recombinant COX2 is utilized in:

  1. SDS-PAGE: Purity validation and structural analysis .

  2. ELISA: Detection of COX2-specific antibodies or protein interactions .

  3. Mitochondrial Biogenesis Studies: Investigating OXA2b-dependent membrane insertion mechanisms .

Handling and Stability Guidelines

ParameterRecommendation
ReconstitutionUse deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage
Freezing/ThawingAvoid repeated cycles; aliquot into single-use vials
Working AliquotsStore at 4°C for ≤1 week

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
COX2; COXII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
COX2
Target Protein Sequence
MNLIWIFPIAFCDAAEPWQLGFQDPATPMMQGIIDLHNDIFFFLIVILIFVLWMLVRALW HFHYKRNPIPERIVHGTTIEIIWTIFPSIILMFIAIPSFALLYSMDEVVDPAITIKAIGH QWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEVDNRVVVPAKTHLRMIITSA DVLHSWAVPSLGVKCDAVPGRLNQTSIFIKREGVYYGQCSELCGTNHGFMPIVVEAVSLD DYVSWVSNKLD
Uniprot No.

Target Background

Function

Recombinant Marchantia polymorpha Cytochrome c oxidase subunit 2 (COX2): A component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthase and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1—a binuclear center (BNC) formed by heme A3 and copper B (CuB). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 (COX2) in Marchantia polymorpha?

Cytochrome c oxidase subunit 2 (COX2) is a mitochondrial DNA-encoded component of the respiratory chain complex IV. In Marchantia polymorpha, the COX2 gene (also denoted as mt-CO2) is located in the mitochondrial genome. COX2 functions as part of the electron transport chain and is essential for cellular respiration. Unlike nuclear-encoded genes, mitochondrial genes like COX2 can accumulate somatic mutations and exhibit heteroplasmy, where mutation levels inversely correlate with COX activity . The gene plays a critical role in energy metabolism and has been studied extensively for its evolutionary conservation across plant species .

Why is Marchantia polymorpha a useful model organism for COX2 studies?

Marchantia polymorpha has emerged as a valuable model organism for several reasons:

  • Rapid transformation capabilities: M. polymorpha allows for relatively quick genetic modification studies compared to many other plant species .

  • Evolutionary significance: As a liverwort, M. polymorpha represents an early diverging land plant lineage, providing insights into the evolutionary history of plant mitochondrial genes .

  • Simple genomic architecture: Its relatively simple genome structure facilitates genetic manipulation and analysis .

  • Transformation flexibility: Multiple transformation methods are available, including spore-based, thallus-based, and gemma-based approaches, allowing researchers to choose appropriate techniques based on experimental needs .

  • Potential for protein hyperexpression: Though not fully exploited yet, M. polymorpha has potential for high-level transgene expression when properly regulated .

What are the basic methods for expressing recombinant proteins in Marchantia polymorpha?

Several transformation approaches can be utilized for expressing recombinant proteins in M. polymorpha:

Transformation MethodAdvantagesLimitationsGenetic Background
Spore-basedHigh transformation efficiencyDiverse genetic backgrounds due to sexual reproductionHeterogeneous
Thallus-basedMaintains genetic consistencyLimited scalabilityHomogeneous
Gemma-basedMaintains genetic consistencyImpractical for large-scale applicationsHomogeneous
Chopped-thallusSuperior transformation efficiency, scalable, simplified procedureRequires optimization of media conditionsHomogeneous

For recombinant COX2 expression, researchers typically use Agrobacterium-mediated transformation followed by selection on appropriate antibiotics. The chopped-thallus method represents a significant advancement, generating numerous plant fragments by simply chopping thalli, eliminating complex preprocessing requirements, and demonstrating superior transformation efficiency .

How can I optimize transformation efficiency when working with recombinant COX2 in Marchantia polymorpha?

Optimizing transformation efficiency for recombinant COX2 expression requires careful consideration of several factors:

  • Media selection: Simplified Gamborg's B5 medium can achieve sufficient numbers of transformants, contrary to previous assumptions about its suboptimal nature. Experiment with different media formulations to determine the optimal conditions for your specific constructs .

  • Vector design: For optimal expression, incorporate:

    • Strong promoters like Elongation Factor 1-α (EF1)

    • Appropriate 5' UTR elements to enhance mRNA stability

    • Codon optimization for M. polymorpha

    • Selection markers like the spectinomycin resistance gene (aadA)

  • Targeting strategy: For mitochondrial genes like COX2, consider:

    • Homologous recombination targeting specific intergenic regions

    • Flanking sequences that facilitate proper integration into the genome

    • Using particle bombardment of germinating spores, which offers relatively high efficiency

  • Post-transformation selection: Implement a robust selection strategy using appropriate antibiotics and, if applicable, fluorescence-based sorting methods like FACS to isolate transformants .

What approaches can be used to study polymorphic variations in recombinant COX2 genes?

Studying polymorphic variations in recombinant COX2 genes requires multi-faceted approaches:

  • Sequencing strategies:

    • Target the mt-CO2 region using specific PCR primers (e.g., 5'-AGCACCCTAATCAACTGGCTTCAA-3' and 5'-CTTCGCAGGCGGCAAAGACTA-3')

    • Implement next-generation sequencing to identify minor variants

    • Consider both genomic DNA and RNA sequencing to identify variations at both levels

  • Restriction fragment length polymorphism (RFLP):

    • Design specific PCR primers to amplify the region of interest

    • Select appropriate restriction enzymes based on potential polymorphic sites

    • Analyze digestion products through gel electrophoresis

  • Functional analysis of polymorphisms:

    • Create site-directed mutants representing identified polymorphisms

    • Compare enzyme activities between wild-type and variant forms

    • Assess impacts on mitochondrial function using oxygen consumption measurements

  • Heteroplasmy quantification:

    • Develop qPCR assays to quantify the ratio of wild-type to mutant mtDNA

    • Correlate heteroplasmy levels with COX enzyme activity

    • Track changes in heteroplasmy levels over time or under different conditions

How can transcription start sites and regulatory elements be identified for recombinant COX2 expression?

Identifying transcription start sites (TSS) and regulatory elements is crucial for optimizing recombinant COX2 expression. Methodology should include:

  • Differential RNA sequencing (dRNAseq):

    • Treat RNA samples with Terminator 5' phosphate-dependent exonuclease (TEX) to selectively degrade RNAs with 5' monophosphate termini while preserving primary transcripts

    • Compare sequencing results between treated and untreated samples to identify enriched regions corresponding to transcription start sites

    • Map identified TSSs to genomic locations relative to start codons

  • Promoter and 5'UTR characterization:

    • Analyze sequences upstream of TSSs for conserved promoter elements

    • Examine the region between TSS and start codon to identify regulatory 5'UTR elements

    • Compare identified elements with those from highly expressed genes like psbA and rbcL, which typically show high mRNA accumulation

  • Functional validation:

    • Create reporter constructs with identified promoters and regulatory elements

    • Test expression levels using fluorescent reporters or other easily measurable proteins

    • Compare expression levels between different promoters and UTR combinations to identify optimal regulatory elements

How does heteroplasmy in COX2 affect recombinant expression and function?

Heteroplasmy—the presence of multiple mitochondrial DNA variants within a cell—significantly impacts COX2 expression and function:

What are the evolutionary implications of studying COX2 in Marchantia polymorpha?

Evolutionary analysis of COX2 in M. polymorpha offers significant insights:

  • Phylogenetic position:

    • As a liverwort, M. polymorpha represents an early diverging lineage of land plants

    • COX2 sequences provide information about mitochondrial gene evolution during the water-to-land transition

    • Comparative analysis with other plant groups can reveal conserved functional domains

  • Intron evolution:

    • The mitochondrial genome of M. polymorpha contains group II introns showing evidence of intra-genomic propagation

    • Some introns propagated after the evolutionary separation of bryophytes from other plant clades

    • Maturase-like sequences in these introns have evolved through horizontal transfer and independent transposition from fungal introns

  • Selection pressures:

    • Synonymous polymorphisms are less frequent in highly conserved genes like COX1 compared to less conserved genes like COX3

    • This suggests selection pressure even on synonymous polymorphisms, indicating they are not functionally silent

    • Analysis of non-synonymous to synonymous substitution ratios can reveal regions under positive or purifying selection

How can potential off-target effects be identified and mitigated in COX2 transgenic expression studies?

When designing and implementing COX2 transgenic expression studies, researchers should consider these approaches to identify and mitigate off-target effects:

  • Comprehensive phenotypic screening:

    • Monitor growth rates, morphology, and developmental timing

    • Assess organelle function beyond mitochondria (chloroplasts, peroxisomes)

    • Examine stress responses using appropriate biomarkers

  • Molecular monitoring techniques:

    • Implement transcriptome profiling to detect unexpected gene expression changes

    • Use proteomics to identify altered protein levels or post-translational modifications

    • Apply metabolomics to detect metabolic pathway disruptions

  • Control strategies:

    • Use inducible expression systems (e.g., tamoxifen-inducible Cre-mediated recombination) to control timing and levels of expression

    • Include proper vector-only and wild-type controls

    • Consider generating multiple independent transgenic lines with varying expression levels

  • Aging and senescence considerations:

    • Monitor markers of cellular senescence (SA-β-gal, p16^Ink4a)

    • Assess DNA damage markers like phospho-H2AX

    • Be aware that altered COX2 expression may affect aging-related phenotypes

How can I address low transformation efficiency in Marchantia polymorpha COX2 experiments?

When facing low transformation efficiency, consider these troubleshooting approaches:

  • Optimize transformation protocol:

    • Try the chopped-thallus transformation method, which demonstrates superior efficiency compared to traditional approaches

    • Adjust co-cultivation time with Agrobacterium to find the optimal duration

    • Optimize the density of plant material and bacterial culture

  • Media and selection improvements:

    • Test simplified Gamborg's B5 medium, which can achieve sufficient transformants despite being previously considered suboptimal

    • Adjust antibiotic concentration for optimal selection without excessive toxicity

    • Consider supplementing with antioxidants or growth regulators to improve plant recovery

  • Vector design refinements:

    • Ensure proper design of flanking sequences for homologous recombination

    • Optimize codon usage for M. polymorpha

    • Test multiple promoter and UTR combinations to identify the most efficient expression system

  • Technical considerations:

    • For particle bombardment, adjust parameters like helium pressure, particle size, and target distance

    • Ensure plant material is in optimal physiological condition before transformation

    • Consider pre-treating plant material to improve competency

What methods can detect and quantify proper integration and expression of recombinant COX2?

To verify successful integration and expression of recombinant COX2, implement these methodologies:

  • Genomic integration verification:

    • Design PCR primers spanning the integration junction sites

    • Perform Southern blot analysis to confirm single or multiple integration events

    • Use next-generation sequencing to verify the complete sequence of the integrated construct

  • Expression analysis:

    • Implement RT-PCR and qRT-PCR to quantify mRNA levels

    • Use Northern blot analysis to assess transcript size and stability

    • If appropriate, incorporate epitope tags or fluorescent proteins for protein detection

  • Protein detection and quantification:

    • Develop specific antibodies against recombinant COX2 or use tagged versions

    • Implement Western blot analysis to confirm protein expression and size

    • Use mass spectrometry to verify protein identity and potential modifications

  • Functional assays:

    • Measure COX enzyme activity using spectrophotometric methods

    • Assess mitochondrial respiration rates using oxygen consumption assays

    • Evaluate ATP production as a downstream indicator of functional integration

How can I differentiate between effects caused by recombinant COX2 expression versus transformation-related stress?

Distinguishing genuine COX2 effects from transformation stress requires careful experimental design:

  • Essential controls:

    • Include vector-only transformants expressing only selection markers

    • Generate transformants with non-functional COX2 variants (e.g., catalytically inactive mutants)

    • Compare multiple independent transformation events with varying expression levels

  • Temporal analysis:

    • Implement inducible expression systems to control timing of COX2 expression

    • Monitor phenotypes before and after induction

    • Allow sufficient recovery time post-transformation before phenotypic analysis

  • Rescue experiments:

    • Attempt to rescue observed phenotypes using COX2 inhibitors

    • Express wild-type COX2 in affected lines to determine if phenotypes can be reversed

    • If using tagged COX2, verify that tag removal restores normal function

  • Stress markers assessment:

    • Monitor canonical stress response pathways activation

    • Measure oxidative stress markers and antioxidant enzyme activities

    • Assess DNA damage markers like phospho-H2AX to distinguish specific effects

How can recombinant COX2 expression in Marchantia polymorpha be used to study evolutionary conservation of respiratory complex assembly?

Recombinant COX2 expression provides valuable opportunities to investigate evolutionary aspects of respiratory complex assembly:

  • Complementation studies:

    • Express M. polymorpha COX2 in other species with COX2 mutations or deletions

    • Test functional compatibility of COX2 from different evolutionary lineages

    • Identify conserved interaction domains through chimeric protein approaches

  • Structural biology approaches:

    • Use recombinant expression to produce sufficient protein for structural studies

    • Implement cryo-EM or X-ray crystallography to determine structural details

    • Compare structures between evolutionary distant organisms to identify conserved features

  • Interaction partners identification:

    • Use tagged recombinant COX2 for co-immunoprecipitation studies

    • Implement BioID or proximity labeling to identify interaction partners

    • Compare interactomes between species to identify conserved and divergent interactions

  • Assembly pathway investigation:

    • Track the assembly process using pulse-chase experiments with labeled proteins

    • Identify assembly intermediates through blue native PAGE analysis

    • Determine the role of specific chaperones and assembly factors across species

What are the considerations for designing site-directed mutagenesis studies of recombinant COX2 in Marchantia polymorpha?

When designing site-directed mutagenesis studies, researchers should consider:

  • Target selection strategy:

    • Focus on conserved residues identified through multiple sequence alignments

    • Target known polymorphic sites to assess their functional significance

    • Consider residues involved in protein-protein interactions or catalytic function

  • Mutagenesis approaches:

    • Implement overlapping PCR techniques for introducing specific mutations

    • Consider using CRISPR-Cas9 for precise genomic edits

    • Create libraries of mutations to perform comprehensive structure-function analyses

  • Functional assessment methods:

    • Develop assays for COX activity measurement in transformed plants

    • Assess growth rates and fitness of mutant lines

    • Implement biochemical analyses to determine enzyme kinetics parameters

  • Structural considerations:

    • Use homology modeling to predict the impact of mutations

    • Consider both local and global effects on protein structure

    • Verify proper folding of mutant proteins before functional interpretation

How can heterologous expression systems be optimized for functional studies of Marchantia polymorpha COX2?

Optimizing heterologous expression requires careful system selection and modification:

  • Expression system selection:

    • Consider using other plant systems for evolutionary studies

    • Evaluate bacterial or yeast systems for high-yield protein production

    • Assess mammalian cell lines for functional studies requiring complex post-translational modifications

  • Codon optimization considerations:

    • Analyze codon usage bias in the target expression system

    • Optimize codons while preserving regulatory elements

    • Consider impact of codon optimization on mRNA secondary structure and stability

  • Subcellular targeting strategies:

    • Include appropriate mitochondrial targeting sequences compatible with the host system

    • Verify proper subcellular localization using fluorescent tags or fractionation

    • Consider using split-GFP approaches to confirm membrane insertion orientation

  • Post-translational processing:

    • Assess differences in post-translational modifications between systems

    • Identify required chaperones or assembly factors that may need co-expression

    • Implement proteomics to verify proper processing of the mature protein

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.