Recombinant Marchantia polymorpha Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Cytochrome c oxidase subunit 3 (COX3) is a core component of Complex IV in the mitochondrial electron transport chain, facilitating oxygen reduction to water during cellular respiration. The recombinant version, derived from the liverwort Marchantia polymorpha, retains the functional and structural characteristics of the native enzyme while enabling scalable production for biochemical studies .

Production and Purification

The protein is produced via heterologous expression in E. coli and purified using affinity chromatography.

Key Production Parameters

  • Expression System: Escherichia coli BL21(DE3) or similar strains .

  • Tag: His-tag for immobilized metal-ion affinity chromatography (IMAC) .

  • Form: Lyophilized powder or glycerol-supplemented liquid .

  • Yield: Typically 0.1–1.0 mg/mL after reconstitution .

Applications in Research

  • Enzyme Activity Assays: Used to study COX3’s role in electron transport kinetics and oxygen reduction .

  • Structural Biology: Serves as a template for crystallography or cryo-EM to resolve Complex IV architecture .

  • Comparative Genomics: Facilitates evolutionary studies of mitochondrial genes in bryophytes vs. vascular plants .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for precise delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX3; COXIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
COX3
Target Protein Sequence
MSVSQKHPFHLVDPSPWPLLGSLGALASTIGGVMYMHSFTGGGTLLCLGLGMILYTMFVW WRDVIRESTYEGHHTFVVQLGLRYGIILFIVSEVMFFLAFFWAFFHSSLAPTVEIGAIWP PKGISVLDPWGIPFLNTLILLSSGAAVTWAHHAILAGLKQQAVYALIATVFLALVFTGFQ GIEYIEAPFTISDGIYGSTFFLATGFHGFHVIIGTIFLIICGIRQYLGHFTPKHHFGFEA AAFYWHFVDVVWLFLFVSIYWWGGN
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient powers transmembrane transport and the ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Marchantia polymorpha and why is it valuable for COX3 research?

Marchantia polymorpha is an emerging model plant among basal land plants with several advantages for genetic studies, including low genetic redundancy, a haploid-dominant life cycle, and highly efficient transformation methods . As a liverwort representing an early divergent lineage of extant land plants, M. polymorpha offers unique evolutionary insights . For COX3 research specifically, this organism provides a simplified genetic background compared to more complex plants, allowing researchers to study this protein's function with reduced interference from genetic redundancy or complex regulatory networks. The genomic resources for M. polymorpha continue to expand, with projects such as MarpolBase providing comprehensive sequence information .

What is the structure and function of Cytochrome c oxidase subunit 3 in plants?

Cytochrome c oxidase subunit 3 (COX3) is an essential component of the cytochrome c oxidase complex, the terminal enzyme of the respiratory electron transport chain. While direct structural data from M. polymorpha COX3 is limited, studies in other organisms like Paracoccus denitrificans show that COX3 influences the conformation of other subunits in the complex . The secondary structure analysis indicates that COX3 typically contains multiple alpha-helices (about 44%), with beta-sheets (18%), beta-turns (14%), loops (18%), and non-ordered segments (6%) .

Of the seven predicted alpha-helices in COX3, only four demonstrate the stability expected of transmembrane helices when subjected to thermal challenges . This suggests that while COX3 is primarily a membrane protein, not all of its helical regions are embedded in the membrane. The protein plays a crucial role in maintaining the structural integrity of the cytochrome c oxidase complex, as its absence leads to conformational changes in the catalytic subunits I and II .

What transformation methods can be used for expressing recombinant proteins in Marchantia polymorpha?

Two primary transformation methods are available for recombinant protein expression in M. polymorpha:

  • Agrobacterium-mediated nuclear transformation: This method has been optimized for high throughput by scaling down protocols to use multiwell plates instead of flasks. This approach allows researchers to perform multiple transformations simultaneously, generating positive transformants in approximately two weeks . The OpenPlant toolkit provides three selectable markers for this method: hygromycin phosphotransferase gene (hptII), modified acetolactate synthase gene (mALS), and neomycin phosphotransferase II gene (nptII), conferring resistance to hygromycin, chlorsulfuron, and kanamycin, respectively .

  • Chloroplast transformation: This method uses biolistic delivery of DNA-loaded microcarriers into plastids. The DNA constructs contain flanking homologous sequences that integrate into specific chloroplast genome locations via homologous recombination . Recent modifications using nanoparticles called DNAdel™ as plasmid DNA carriers have improved efficiency and reproducibility. Using spores from a single sporangium can yield approximately 10 transplastomic plants after eight weeks of selection, with greater than 90% of plants achieving homoplasmy .

How do I prepare Marchantia polymorpha tissue for transformation experiments?

The preparation of M. polymorpha tissue for transformation follows a systematic approach:

  • Spore production: Efficient nuclear and chloroplast transformation methods rely on sterile sporelings (germinating spores) as target tissue. For reliable production of sterile spores, use Microbox micropropagation containers with a specially designed lid that allows gas exchange while preventing contamination .

  • Growth conditions: Grow plantlets or gemmae under axenic conditions in a controlled environment cabinet. Supplementary far-red light triggers the sexual phase, with efficient formation of male and female gametophores after 4 weeks in Cam-1 and Cam-2 strains of M. polymorpha .

  • Cross-fertilization: Harvest mature sperm from antheridia (male sex organs), dilute, and transfer to archegonia (female sex organs). Yellow sporangia containing spores emerge after approximately 4 weeks .

  • Spore storage and sterilization: Store spores in cold, desiccated conditions and sterilize prior to plating on suitable medium for germination .

  • Transformation timing: For nuclear transformation, use 4-5 day old sporelings. For chloroplast transformation, sporelings regenerate after biolistic delivery without requiring hormone treatment .

What selectable markers and reporter systems are available for Marchantia polymorpha research?

The OpenPlant toolkit provides several selectable markers and reporter systems for M. polymorpha research:

Selectable markers:

  • Hygromycin phosphotransferase gene (hptII) - confers hygromycin resistance

  • Modified acetolactate synthase gene (mALS) - confers chlorsulfuron resistance

  • Neomycin phosphotransferase II gene (nptII) - confers kanamycin resistance

  • Aminoglycoside adenyltransferase (aadA) - confers spectinomycin resistance (for chloroplast transformation)

Reporter systems:

  • mTurquoise2 fluorescent protein - has been successfully expressed under the control of the MpUBE2 promoter for ubiquitous labeling of cell boundaries

  • Promoter fusion constructs - such as the MpRSL3 promoter fused to fluorescent proteins to study dynamic changes in expression patterns, particularly useful for tracking developmental processes such as rhizoid formation

How can I investigate the role of COX3 in maintaining cytochrome c oxidase complex stability in Marchantia polymorpha?

To investigate COX3's role in maintaining cytochrome c oxidase complex stability, consider the following methodological approach:

  • Generate COX3 knockout mutants: Use CRISPR/Cas9 or homologous recombination to create COX3-deficient M. polymorpha lines. The efficient transformation protocols available for M. polymorpha facilitate this approach .

  • Structural analysis: Employ infrared spectroscopy to analyze the secondary structure of the cytochrome c oxidase complex in wild-type and COX3-deficient plants. Based on results from P. denitrificans, you should look specifically for changes in loop regions of subunits I and II, which increase from 18% to 24% in the absence of subunit III .

  • Thermal stability assays: Perform thermal infrared studies to assess the denaturation pattern of the complex. In P. denitrificans, this revealed a complex pattern with a partially denatured intermediate state .

  • Functional analysis: Compare the enzymatic activity of the cytochrome c oxidase complex in wild-type and COX3-deficient plants to determine how structural changes impact function.

  • Interaction mapping: Use band/area ratios and tyrosine side chain absorption to identify regions where subunit III interacts with the catalytic subunits, focusing on potential interaction surfaces located outside the lipid bilayer .

What strategies can optimize expression and purification of recombinant COX3 in Marchantia polymorpha?

For optimal expression and purification of recombinant COX3 in M. polymorpha, consider this comprehensive approach:

  • Expression system selection:

    • For membrane proteins like COX3, chloroplast transformation may be advantageous due to the organelle's ability to properly fold membrane proteins and provide a lipid environment .

    • Use the aminoglycoside adenyltransferase (aadA) resistance gene as a selectable marker for chloroplast transformation .

  • Expression optimization:

    • Codon optimization based on M. polymorpha chloroplast codon usage preferences

    • Use of strong chloroplast promoters (consider adapting strategies from the OpenPlant toolkit)

    • Addition of appropriate targeting sequences

  • Construct design:

    • Include affinity tags (His-tag or Strep-tag) for purification

    • Consider fusion partners that enhance solubility and stability

    • Include TEV protease cleavage sites for tag removal

  • Growth conditions:

    • Optimize culture conditions using multiwell plates for screening different parameters

    • Use the micropropagation containers with specialized lids for scaled-up cultivation

  • Purification strategy:

    • Develop membrane solubilization protocols using mild detergents

    • Implement affinity chromatography followed by size exclusion chromatography

    • Monitor protein integrity using infrared spectroscopy to verify secondary structure content

How do genetic variations across Marchantia polymorpha subspecies impact COX3 function and structure?

The genetic diversity within the M. polymorpha complex provides a natural laboratory for studying COX3 structure-function relationships:

  • Comparative genomic analysis: Compare COX3 sequences across the three recognized subspecies: subsp. polymorpha, subsp. ruderalis, and subsp. montivagans . These subspecies are morphologically differentiated and represent distinct evolutionary lineages.

  • Evolutionary pressure analysis: Calculate non-synonymous to synonymous substitution ratios to identify regions under selective pressure.

  • Introgression studies: Investigate whether COX3 has been subject to introgression between subspecies. Evidence of hybridization and introgression has been documented in the M. polymorpha complex .

  • Functional comparison: Express COX3 variants from different subspecies in a common genetic background to assess functional differences.

  • Structure prediction: Use evolutionary data to inform structural models of COX3, particularly focusing on the four alpha-helices identified as stable transmembrane regions in P. denitrificans .

The following table summarizes key characteristics of M. polymorpha subspecies relevant to COX3 studies:

SubspeciesFormer NameEcological NicheNotable Genetic Features
subsp. polymorphaM. aquaticaAquatic environmentsType specimen for M. polymorpha
subsp. ruderalisM. polymorphaGeneralist habitatsCorresponds to the original M. polymorpha sensu Burgeff
subsp. montivagansM. alpestrisMontane habitatsShows evidence of introgression with other subspecies

How can I use synthetic biology approaches to engineer modified COX3 in Marchantia polymorpha?

The OpenPlant toolkit provides a foundation for synthetic biology approaches to COX3 engineering:

  • Modular cloning system: Utilize standardized genetic parts from the OpenPlant toolkit to create expression constructs with different regulatory elements and tags .

  • Promoter engineering: Test different promoters for optimal expression. The MpRSL3 promoter has been used successfully to study dynamic expression patterns and could be adapted for COX3 expression .

  • Domain swapping: Engineer chimeric proteins by swapping domains between COX3 from different organisms to investigate functional conservation and specialization.

  • Structure-guided mutagenesis: Based on knowledge that only four of seven predicted alpha-helices in COX3 behave as typical transmembrane helices , design mutations targeting specific structural elements.

  • In vivo screening: Develop high-throughput screening methods utilizing multiwell plates for culture and microscopic observation , allowing rapid assessment of multiple COX3 variants.

  • Functional coupling: Engineer COX3 variants with fluorescent tags to monitor localization and assembly with other cytochrome c oxidase subunits in vivo.

What methods can determine how COX3 mutations affect electron transport chain efficiency in Marchantia polymorpha?

To assess the impact of COX3 mutations on electron transport chain efficiency, implement the following methodological framework:

  • Generation of mutant libraries:

    • Create point mutations in conserved residues based on sequence alignments

    • Focus particularly on the four stable alpha-helical regions identified in thermal studies

    • Generate mutations in regions predicted to interact with subunits I and II

  • Respiratory activity assays:

    • Measure oxygen consumption rates in wild-type and mutant lines

    • Assess cytochrome c oxidase activity using spectrophotometric assays

    • Evaluate proton pumping efficiency using pH-sensitive fluorescent dyes

  • Structural integrity assessment:

    • Use infrared spectroscopy to analyze secondary structure changes in mutants

    • Compare the percentages of alpha-helix, beta-sheet, beta-turns, and loops to wild-type values (44%, 18%, 14%, and 18%, respectively)

  • Electron microscopy:

    • Examine the ultrastructure of mitochondria in wild-type and mutant lines

    • Assess cytochrome c oxidase complex assembly using immunogold labeling

  • Metabolic profiling:

    • Compare metabolite profiles between wild-type and mutant lines to identify metabolic bottlenecks

    • Quantify ATP production to directly assess the functional impact of mutations

  • Stress response analysis:

    • Evaluate the performance of wild-type and mutant lines under various stress conditions

    • Test specifically for conditions that increase metabolic demand on the electron transport chain

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.