Recombinant Marchantia polymorpha NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND6; NAD6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
ND6
Target Protein Sequence
MILFYVFVVLALVSGAMVIRAKNPVHSVLFLILVFCNTSGLLVLLGLDFFAMIFLVVYVG AIAVLFLFVVMMLHIRIEEIHENVLRYLPVGGIIGLIFLLEIFLMVDNDYIPILPTKLSA TYLTYTVYAGKIHSWTNLETLGNLLYTTYFFLFLVSSLILLVALIGAIVLTMHKTTKVKR QDVFIQNAIDFQNTIKKVR
Uniprot No.

Target Background

Function
Recombinant *Marchantia polymorpha* NADH-ubiquinone oxidoreductase chain 6 (ND6) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of ND6 in Marchantia polymorpha?

ND6 is one of the mitochondrial genes encoding NADH dehydrogenase subunit proteins in Marchantia polymorpha. The Marchantia genome is relatively small (280Mbp) with 8 autosomes and 1 sex chromosome. The genetic redundancy in Marchantia is low, with most major gene families represented by a single or a few orthologs . The ND6 gene is part of the respiratory complex I, and its sequence is homologous to those found in other organisms, including yeasts and other plants . In Marchantia, equivalent genes have been identified in the chloroplast genome as well .

What are the most effective transformation systems for recombinant expression in Marchantia polymorpha?

Agrobacterium-mediated transformation has proven highly effective for Marchantia polymorpha, particularly using sporelings (immature thalli developed from spores). This system can generate hundreds of stable transformants per sporangium, making it advantageous for gene targeting experiments . The efficiency of this method is a significant advantage when working with recombinant proteins in Marchantia, including ND6. The transformation protocol involves:

  • Preparation of Agrobacterium carrying the gene construct

  • Co-cultivation with Marchantia sporelings

  • Selection of transformants using appropriate antibiotics

  • Screening for successful integration

This method yields a substantial number of transformants that can be further screened for successful recombination events .

How can homologous recombination be optimized for ND6 modification in Marchantia polymorpha?

Optimizing homologous recombination for ND6 modification in Marchantia polymorpha requires careful consideration of several factors:

  • Homologous arm length: The efficiency of homologous recombination is influenced by the length of homologous arms. For successful gene targeting in Marchantia, as demonstrated with the NOP1 gene, homologous arms of 3.5-3.6 kb have been effective .

  • Selection strategy: A positive/negative selection system using hygromycin resistance (hpt) as a positive selection marker and diphtheria toxin A (DT-A) as a negative selection marker has been shown to reduce non-homologous random integration .

  • Targeting construct design: For effective targeting of ND6, the construct should include:

    • The hpt resistance cassette flanked by homologous regions

    • DT-A gene outside the homologous region to eliminate random integration events

    • Precise targeting of exonic regions to ensure functional disruption

Using this approach, homologous recombination frequencies of approximately 2% can be achieved among transformants that pass the positive/negative selection .

What validation methods should be employed to confirm successful ND6 gene targeting?

Multiple validation approaches should be used to confirm successful ND6 gene targeting:

  • PCR validation: Design primer pairs that span the integration junctions (both 5' and 3' junctions) to verify correct integration. Additionally, use primers spanning the target region to confirm replacement of the wild-type sequence .

  • Southern blot analysis: This provides definitive evidence of correct integration and can confirm single-copy integration events. Digestion with appropriate restriction enzymes followed by hybridization with probes specific to the integration cassette and flanking regions is recommended .

  • Phenotypic analysis: For ND6, which is involved in respiration, phenotypic validation might include measuring respiratory capacity, growth on different carbon sources, or specific enzymatic activities of complex I.

  • Transcript analysis: RT-PCR or RNA-seq to confirm proper expression patterns or disruption of the target gene.

  • Protein analysis: Western blotting or proteomic approaches to confirm protein expression or absence in knockout lines.

How can CRISPR-Cas9 technology be adapted for precise ND6 editing in Marchantia polymorpha?

While traditional homologous recombination has been effective in Marchantia, CRISPR-Cas9 offers potential advantages for precise ND6 editing. The haploid gametophytic generation of Marchantia polymorpha makes it particularly amenable to gene editing approaches . For adapting CRISPR-Cas9 to ND6 editing:

  • gRNA design: Select target sequences specific to ND6 with minimal off-target effects. The low genetic redundancy in Marchantia simplifies target identification .

  • Delivery method: Utilize the established Agrobacterium-mediated transformation system for delivering the CRISPR-Cas9 components.

  • Repair template design: For precise edits, include homology arms of appropriate length (similar to those used in homologous recombination approaches).

  • Selection strategy: Implement a positive/negative selection system similar to that used in homologous recombination approaches.

  • Validation: Employ comprehensive validation including sequencing to confirm precise edits at the nucleotide level.

The efficiency of CRISPR-Cas9 editing in Marchantia for genes like ND6 is expected to exceed the 2% rate observed with traditional homologous recombination .

What are the challenges in studying protein-protein interactions involving recombinant ND6 in Marchantia polymorpha?

Investigating protein-protein interactions involving recombinant ND6 presents several challenges:

  • Membrane protein isolation: As a component of complex I, ND6 is a hydrophobic membrane protein, making isolation while maintaining native conformation difficult.

  • Complex assembly: ND6 functions as part of a large multi-subunit complex, requiring consideration of other complex I components for meaningful interaction studies.

  • Native versus recombinant environment: Interactions observed with recombinant proteins may differ from those in the native environment due to differences in post-translational modifications or protein folding.

  • Technical approaches: Methods such as co-immunoprecipitation or yeast two-hybrid may have limitations for membrane proteins like ND6.

To address these challenges, researchers might consider:

  • Using epitope tags that minimally interfere with protein function

  • Employing proximity labeling approaches such as BioID or APEX2

  • Utilizing split reporter systems adapted for membrane proteins

  • Developing organelle-specific interaction assays

How can comparative genomics inform functional studies of ND6 across bryophyte lineages?

Comparative genomics approaches can provide valuable insights into ND6 function across bryophyte lineages:

  • Sequence conservation analysis: Identifying highly conserved regions within ND6 across bryophytes can highlight functionally critical domains.

  • Synteny analysis: Examining the genomic context of ND6 in different bryophytes can reveal conserved gene clusters that might indicate functional relationships.

  • Selection pressure analysis: Calculating dN/dS ratios across different regions of ND6 can identify sites under purifying or positive selection.

  • Structure prediction: Using sequence data from multiple species to inform structural models of ND6, particularly for conserved functional domains.

The Marchantia genome databases (MarpolBase and MarpoDB) provide valuable resources for such comparative analyses, with approximately 20,000 loci identified in the Tak-1 strain and about 13,000 loci in the Cam-1 strain .

What experimental design is optimal for studying ND6 function in Marchantia polymorpha?

An optimal experimental design for studying ND6 function should include:

  • Gene modification approaches:

    • Complete knockout via homologous recombination

    • Point mutations in key residues using precise editing techniques

    • Conditional expression systems to study essential functions

  • Phenotypic characterization:

    • Growth analysis under different respiratory conditions

    • Metabolic profiling to assess changes in energy metabolism

    • Stress response characterization, particularly to oxidative stress

  • Biochemical analysis:

    • Complex I activity assays

    • Respiration measurements

    • ROS production quantification

  • Control experiments:

    • Complementation with wild-type ND6 to confirm phenotype causality

    • Comparison with other respiratory chain mutants

    • Inclusion of appropriate wild-type controls

The haploid nature of Marchantia gametophytes simplifies these analyses by eliminating complications from heterozygosity .

How can researchers troubleshoot low transformation efficiency when working with recombinant ND6?

When encountering low transformation efficiency with recombinant ND6 constructs:

  • Optimize Agrobacterium conditions:

    • Ensure appropriate Agrobacterium strain (e.g., GV2260, GV3101)

    • Optimize bacterial density (OD600 0.5-1.0 typically works well)

    • Adjust co-cultivation time (2-3 days is standard)

  • Evaluate construct design:

    • Check for toxic effects of the construct on Agrobacterium

    • Ensure proper design of homologous arms

    • Verify DT-A negative selection marker functionality

  • Optimize spoiling conditions:

    • Use freshly germinated sporelings (1-2 days post-germination)

    • Ensure appropriate spore density for transformation

    • Control environmental conditions during co-cultivation

  • Adjust selection parameters:

    • Optimize antibiotic concentration for positive selection

    • Implement staged selection to reduce stress on transformants

Based on previous successful transformations in Marchantia, expect approximately 10-20% of spores to germinate after imbibition, with potential to obtain hundreds of hygromycin-resistant transformants per sporangium when using optimal conditions .

What are the most common pitfalls in analyzing ND6 gene targeting results and how can they be avoided?

Common pitfalls in analyzing ND6 gene targeting results include:

  • Misinterpreting non-homologous recombination events:

    • Solution: Perform comprehensive molecular validation including PCR across both integration junctions and Southern blot analysis .

  • False positives from incomplete selection:

    • Solution: Implement rigorous positive/negative selection and verify through multiple rounds of selection .

  • Misattribution of phenotypes:

    • Solution: Perform complementation studies and analyze multiple independent transformants.

  • Off-target effects:

    • Solution: Sequence potential off-target sites and verify specificity of genomic modifications.

  • Mistaking ectopic gene targeting (EGT) for true homologous recombination:

    • Solution: Use PCR primers that can distinguish between intact and modified target loci .

When targeting ND6, researchers should expect approximately 2% of transformants that pass positive/negative selection to contain the desired homologous recombination event, based on similar experiments with other Marchantia genes .

What statistical approaches are most appropriate for analyzing respiratory chain function in ND6 mutants?

Appropriate statistical approaches for analyzing respiratory chain function in ND6 mutants include:

  • For growth rate comparisons:

    • ANOVA with post-hoc tests for comparing multiple mutant lines

    • Mixed-effects models for time-course growth experiments

    • Non-parametric alternatives (e.g., Kruskal-Wallis) when normality assumptions are violated

  • For enzymatic activity measurements:

    • Multiple t-tests with correction for multiple comparisons

    • Regression analysis for enzyme kinetics data

    • Bootstrap methods for robust confidence interval estimation

  • For respiration rate analysis:

    • Repeated measures ANOVA for oxygen consumption experiments

    • Non-linear regression for analyzing respiratory control ratios

  • For experimental design and power analysis:

    • A priori power calculations based on expected effect sizes

    • Sample size determination to achieve statistical significance

When reporting results, include both biological and technical replicates (minimum n=3 for each), appropriate measures of central tendency and dispersion, and exact p-values rather than threshold reporting.

How can researchers distinguish between primary effects of ND6 modification and secondary metabolic adaptations?

Distinguishing primary effects from secondary adaptations requires careful experimental design:

  • Time-course analysis:

    • Early changes after gene modification are more likely to be primary effects

    • Late-emerging phenotypes may represent adaptive responses

  • Conditional expression systems:

    • Inducible expression allows observation of immediate consequences

    • Comparing acute vs. chronic effects helps separate primary and secondary impacts

  • Metabolic flux analysis:

    • Stable isotope labeling to track metabolic pathway alterations

    • Identifying metabolic bottlenecks that directly result from ND6 dysfunction

  • Comparative analysis:

    • Compare with other complex I mutants affecting different subunits

    • Identify common vs. specific responses across respiratory chain mutants

  • Transcriptomic and proteomic profiling:

    • Early transcriptional responses to identify direct regulatory effects

    • Pathway enrichment analysis to identify compensatory mechanisms

A systematic approach combining these strategies provides the most comprehensive distinction between primary effects and secondary adaptations.

What bioinformatic tools are most valuable for analyzing evolutionary conservation of ND6 across plant lineages?

Key bioinformatic tools for analyzing ND6 evolutionary conservation include:

  • Multiple sequence alignment tools:

    • MUSCLE or MAFFT for accurate alignment of ND6 sequences

    • T-Coffee for incorporating structural information into alignments

  • Phylogenetic analysis software:

    • RAxML or IQ-TREE for maximum likelihood tree construction

    • MrBayes for Bayesian phylogenetic inference

    • PAML for detecting selection signatures

  • Visualization tools:

    • Jalview for visualizing sequence conservation patterns

    • iTOL for interactive display of phylogenetic trees with metadata

  • Specialized databases:

    • MarpolBase for Marchantia polymorpha genetic resources

    • MarpoDB for gene-centric database information

    • Plant mitochondrial genome databases for comparative analysis

  • Functional prediction tools:

    • ConSurf for mapping conservation onto protein structures

    • PROVEAN for predicting functional impact of sequence variations

When conducting such analyses, researchers should consider the unique genome characteristics of Marchantia, including its small size (280Mbp) and low genetic redundancy compared to other plant lineages .

How can systems biology approaches integrate ND6 function into broader metabolic networks in Marchantia polymorpha?

Systems biology approaches can contextualize ND6 function within Marchantia's metabolic networks through:

  • Genome-scale metabolic modeling:

    • Constructing a comprehensive metabolic model of Marchantia

    • Performing flux balance analysis with ND6 constraints

    • Identifying metabolic rewiring in response to ND6 modification

  • Multi-omics integration:

    • Correlating transcriptomic, proteomic, and metabolomic data

    • Network analysis to identify regulatory hubs connected to ND6 function

    • Identifying compensatory pathways activated in response to ND6 dysfunction

  • Comparative systems analysis:

    • Contrasting with other bryophytes and land plants

    • Identifying conserved vs. lineage-specific metabolic adaptations

  • Predictive modeling:

    • Machine learning approaches to predict phenotypic consequences of ND6 variants

    • In silico testing of hypotheses about ND6's role in energy metabolism

The low genetic redundancy in Marchantia makes it particularly valuable for systems biology approaches, as pathway components are typically represented by single genes rather than complex families .

What role might ND6 play in the evolutionary adaptation of bryophytes to terrestrial environments?

ND6's potential role in bryophyte adaptation to terrestrial environments may include:

  • Energy metabolism adaptation:

    • Optimization of respiratory efficiency in fluctuating terrestrial conditions

    • Balancing energy production with water conservation requirements

  • Stress response mechanisms:

    • Adaptation to increased oxidative stress in terrestrial environments

    • Modulation of respiratory chain function during desiccation and rehydration

  • Evolutionary trajectory analysis:

    • Comparison of ND6 sequences from aquatic algal ancestors to land plants

    • Identification of bryophyte-specific adaptations in respiratory chain components

  • Functional diversification:

    • Acquisition of regulatory features specific to terrestrial life

    • Integration with signaling pathways responding to terrestrial stressors

Marchantia's position as an early-diverging land plant makes it particularly valuable for understanding these evolutionary transitions. Its genome contains many mechanisms found in land plants, but in a less complex form .

How can synthetic biology applications leverage recombinant ND6 in Marchantia polymorpha for biotechnological applications?

Synthetic biology applications leveraging recombinant ND6 in Marchantia could include:

  • Engineered energy metabolism:

    • Optimizing respiratory efficiency for enhanced biomass production

    • Creating strains with altered NAD+/NADH ratios for specialized metabolism

  • Biosensor development:

    • Engineering ND6 variants sensitive to specific environmental conditions

    • Creating reporter systems linked to respiratory chain function

  • Bioremediation applications:

    • Developing strains with enhanced tolerance to heavy metals or pollutants

    • Engineering metabolic pathways that leverage respiratory chain components

  • Bioproduction platforms:

    • Utilizing Marchantia's efficient transformation system for heterologous protein expression

    • Integrating ND6 modifications with metabolic engineering for high-value compound production

For these applications, researchers can leverage resources such as MarpoDB, which is specifically designed for genetic engineering and synthetic biology purposes with Marchantia polymorpha .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.