Recombinant Marchantia polymorpha Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Functional Role

The Recombinant Marchantia polymorpha Photosystem II CP47 Chlorophyll Apoprotein (psbB) is a chloroplast-encoded protein critical for the structural integrity and function of Photosystem II (PSII). CP47, along with CP43, forms the PSII core antenna complex, facilitating light absorption and energy transfer to the reaction center . The psbB gene encodes this 47 kDa chlorophyll-binding protein, which coordinates approximately 14–16 chlorophyll molecules .

Key functional roles include:

  • Energy transfer from outer light-harvesting complexes to the PSII reaction center .

  • Stabilization of the PSII core architecture, particularly the oxygen-evolving complex (OEC) .

  • Interaction with cytochrome b₆/f complex components for electron transport .

Chloroplast Transcriptome Insights

  • Marchantia polymorpha chloroplasts show high transcriptional activity of psbB, driven by PEP (plastid-encoded RNA polymerase) promoters .

  • The psbB operon includes psbT, psbH, petB, and petD, requiring intricate RNA processing for stability .

Hyperexpression Tools

  • Hybrid promoters (e.g., Nt-psbA) and 5′UTRs (e.g., Mp-rbcL) enable high-yield recombinant CP47 production in Marchantia chloroplasts .

  • Mutations in PPR protein-binding sites reduce mRNA stability, highlighting regulatory mechanisms .

Functional Mutant Studies

  • Chlamydomonas mbb1 mutants lacking CP47 exhibit defective PSII assembly, emphasizing its structural necessity .

  • Arabidopsis hcf107 mutants show disrupted psbH and psbB expression, linking RNA metabolism to PSII integrity .

Biotechnological Relevance

  • Photosynthesis research: Recombinant CP47 aids in studying chlorophyll-protein interactions and energy transfer mechanisms .

  • Chloroplast engineering: Tools developed for Marchantia enable rapid testing of transgene expression, with applications in synthetic biology .

  • Photonics: Fluorescent protein fusions (e.g., mTurq2cp) allow real-time tracking of PSII dynamics .

Challenges and Future Directions

  • Structural resolution: Current models (8 Å) require refinement to resolve chlorophyll orientations .

  • Regulatory networks: Elucidating PPR protein interactions with psbB mRNA remains a priority .

  • Scalable production: Optimizing E. coli expression systems could enhance yield for industrial applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. If you require a particular format, please specify your requirement when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To prevent degradation, aliquot the protein for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITKSWGGWSITGETVTNAGIWSYEGVAAVHIVLSGLLFLAAIWHWVYWDL ELFRDERTGKPSLDLPKIFGIHLFLSGVLCFAFGAFHVTGLFGPGIWISDPYGLTGKVQP VAPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNVETVLSS SIAAVFFAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIDRRIRSSKAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHAVFKDKEGNELFVRRMP TFFETFPVVLVDEQGIVRADVPFRRAESKYSVEQVGVTVEFYGGELDGVSFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQVI
Uniprot No.

Target Background

Function
CP47, a component of the photosystem II (PSII) core complex, plays a crucial role in binding chlorophyll and catalyzing the primary light-induced photochemical reactions within PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of CP47 in Photosystem II?

CP47 is a core antenna protein of Photosystem II (PSII) that plays a crucial role in light harvesting and energy transfer to the reaction center. The protein is encoded by the psbB gene and has a molecular mass of approximately 47 kDa. Structurally, CP47 contains multiple transmembrane helices with several histidine residues positioned in hydrophobic regions that likely serve as chlorophyll binding sites. Research in cyanobacteria has identified five pairs of histidine residues spaced by 13 or 14 amino acids in hydrophobic regions of the protein that are proposed to be involved in chlorophyll binding .

The primary function of CP47 is to bind chlorophyll molecules and transfer excitation energy to the reaction center. While CP47 has been hypothesized to potentially bind reaction center chlorophyll, studies using gene interruption in Synechocystis 6803 have shown that an intact CP47 is required for functional Photosystem II, although this doesn't necessarily prove that the protein houses the reaction center itself .

How conserved is the psbB gene across photosynthetic organisms?

The psbB gene shows significant conservation across photosynthetic organisms, reflecting the essential role of CP47 in photosynthesis. Comparative studies between cyanobacteria and higher plants have revealed substantial homology. For example, the psbB gene from Synechocystis 6803 shows 68% DNA sequence homology with that of spinach, while the predicted amino acid sequence demonstrates even higher conservation at 76% homology .

The hydropathy patterns of CP47 from different species (e.g., Synechocystis and spinach) are nearly indistinguishable, indicating that the general folding pattern of CP47 in the thylakoid membrane is highly conserved across different photosynthetic organisms . This conservation reflects the fundamental importance of this protein in maintaining PSII structure and function throughout evolutionary history.

What methods are commonly used to isolate Photosystem II complexes from Marchantia polymorpha?

Isolation of PSII complexes from Marchantia polymorpha typically employs a combination of detergent solubilization and density gradient ultracentrifugation. One established protocol involves:

  • Isolation of thylakoid membranes from Marchantia polymorpha tissue

  • Solubilization of the membranes using dodecyl β-D-maltoside detergent

  • Separation of the solubilized complexes via glycerol gradient ultracentrifugation

This method yields PSII preparations containing most of the core complex proteins, oxygen-evolving enhancer proteins, and light-harvesting complex (LHC) components. The only component found to be significantly depleted compared to grana membrane preparations is the psbS gene product .

For analysis of protein composition and interactions within the isolated complex, techniques such as chemical cross-linking using cleavable homobifunctional reagents (like dithiobis(sulfosuccinimidylpropionate)) followed by diagonal electrophoresis and immunoblotting have proven effective .

What strategies can be employed for recombinant expression of the psbB gene in Marchantia polymorpha?

Recombinant expression of psbB in Marchantia polymorpha can be achieved through chloroplast transformation techniques. Based on studies of chloroplast gene expression in Marchantia, several strategies can be implemented:

  • Promoter selection: Analysis of untreated dRNaseq samples has identified genes with the highest RNA accumulation in Marchantia chloroplasts. While psbA and rbcL have the highest transcript levels , their promoter elements can be repurposed for expressing recombinant psbB.

  • 5' UTR optimization: The 5' untranslated region significantly impacts translation efficiency. For optimal expression, researchers should consider:

    • Using native 5' UTRs from highly expressed genes like psbA (54 bp upstream of start codon) or rbcL (124 bp upstream)

    • Incorporating synthetic ribosome binding sequences for enhanced translation

  • Transformation vectors: Constructs should contain:

    • The gene of interest under control of a strong chloroplast promoter

    • An antibiotic resistance marker (e.g., aadA conferring spectinomycin resistance)

    • Flanking sequences for homologous recombination into specific regions of the Marchantia plastid genome (e.g., the rbcL-trnR intergenic region)

  • Transformation method: Chloroplast transformation in Marchantia can be achieved by particle bombardment of germinating spores, which are relatively easy to harvest in large numbers .

How can researchers analyze the spatial arrangement of CP47 within the Photosystem II complex?

Understanding the spatial arrangement of CP47 within the PSII complex requires combining biochemical and structural approaches:

  • Chemical cross-linking: Using cleavable homobifunctional cross-linkers such as dithiobis(sulfosuccinimidylpropionate) to form covalent bonds between proximally located proteins within the complex. This can be followed by diagonal electrophoresis (where the cross-linker is cleaved between dimensions) and immunoblotting to identify interaction partners .

  • Electron microscopy: Correlating biochemical data with protein masses revealed by electron microscopy techniques to determine the relative positions of subunits .

  • Mutagenesis: Site-directed mutagenesis of specific residues to identify functional domains and interaction surfaces.

Research utilizing these approaches has demonstrated that CP43 and CP47 are positioned on opposite sides of the D1-D2-cytochrome b559 complex within PSII . The data also supports a model where minor CAB proteins (CP29, CP26) interact with both core complex subunits and LHCII, potentially serving as interfaces between the major LHCII and the reaction center .

What are the challenges in maintaining protein functionality when expressing recombinant CP47?

Expressing functional recombinant CP47 presents several challenges that researchers must address:

  • Cofactor integration: CP47 binds multiple chlorophyll molecules, requiring proper integration of these cofactors during protein folding. Ensuring correct chlorophyll binding is essential for functionality.

  • Membrane integration: As an integral membrane protein with multiple transmembrane domains, CP47 requires specialized expression systems that facilitate proper membrane insertion and folding.

  • Complex assembly: CP47 functions as part of the larger PSII complex, requiring association with other subunits for stability and function. Expression strategies must consider whether to express CP47 alone or co-express with partner proteins.

  • Post-translational modifications: Any species-specific modifications must be accommodated in the expression system.

To address these challenges, researchers might consider:

  • Using homologous expression systems (within Marchantia) rather than heterologous systems

  • Employing chloroplast transformation rather than nuclear transformation to ensure proximity to other photosynthetic machinery

  • Carefully optimizing growth conditions to ensure adequate cofactor availability

How can researchers distinguish between different subspecies of Marchantia polymorpha for photosynthesis studies?

Marchantia polymorpha comprises three recognized subspecies (ruderalis, polymorpha, and montivagans) with distinctive genetic characteristics. For photosynthesis studies, researchers should consider:

  • Genetic markers: Each subspecies is associated with unique chloroplast and mitochondrial haplotype groups, which can serve as reliable markers for identification .

  • Whole-genome sequencing: PacBio sequencing for reference genomes and Illumina resequencing for population studies can definitively distinguish between subspecies .

  • Pseudo-chromosome analysis: Notably, pseudo-chromosome 2 in subsp. montivagans shows much higher divergence than other genomic regions, potentially serving as a diagnostic marker .

Understanding the evolutionary relationships and genetic distinctions between these subspecies is crucial when selecting material for photosynthesis studies, as variations in photosynthetic genes could influence experimental outcomes. Species tree analyses have established that subsp. montivagans likely diverged first, with subsp. ruderalis and subsp. polymorpha appearing as sister lineages .

What is the impact of introgression on photosynthetic gene function in Marchantia polymorpha?

Introgression between Marchantia polymorpha subspecies has been documented and may impact photosynthetic gene function and evolution:

  • Evidence of hybridization: Genomic analyses have revealed introgression between subspecies, particularly when they occur in sympatry. For example, individuals MpmBU3 and MppBV1 show evidence of introgression with subsp. ruderalis and subsp. montivagans, respectively, in restricted parts of their genomes .

  • Differential gene flow: Not all genomic regions show equal levels of introgression. Pseudo-chromosome 2 appears less permeable to gene flow than other regions, possibly due to a higher degree of chromosomal rearrangements .

  • Functional implications: Introgression can potentially transfer adaptive alleles between lineages, which could affect photosynthetic efficiency. In the haploid-dominant bryophyte life cycle, transferred alleles are immediately exposed to selection, potentially accelerating adaptation .

This genetic exchange may contribute to the diversity of photosynthetic traits and should be considered when selecting specimens for photosynthesis research, particularly when studying genes located on differentially introgressed regions of the genome.

Subspecies PairObserved IntrogressionSpore Germination Rate in Experimental CrossesField Observation
montivagans × ruderalisDetected in individual MpmBU3Low (9%) when male montivagans × female ruderalisSympatric populations more common than previously recognized
montivagans × polymorphaDetected in individual MppBV1Higher (50-70%) when female montivagans × male polymorphaParental species pairs occur in sympatry

How can researchers verify the functionality of recombinantly expressed CP47?

Verifying the functionality of recombinantly expressed CP47 requires multiple assessment approaches:

  • Protein accumulation and localization:

    • Western blot analysis using antibodies specific to CP47

    • Confocal microscopy with fluorescent tags to confirm thylakoid membrane localization

  • Complex assembly:

    • Blue native gel electrophoresis to verify incorporation into PSII complexes

    • Co-immunoprecipitation to confirm interaction with other PSII subunits

  • Functional assays:

    • Oxygen evolution measurements to assess PSII activity

    • Chlorophyll fluorescence analysis to evaluate energy transfer efficiency

    • Spectroscopic analysis of chlorophyll binding properties

  • Complementation studies:

    • Expression in psbB-deficient mutants to test restoration of photosynthetic function

    • Comparison of growth rates under photosynthetic conditions

Research in cyanobacteria has demonstrated that interruption of the psbB gene with a kanamycin resistance gene results in loss of Photosystem II activity, confirming that an intact CP47 is required for functional PSII . Similar approaches could be adapted for Marchantia polymorpha studies.

What controls should be included when studying recombinant psbB expression in Marchantia polymorpha?

Rigorous experimental design for studying recombinant psbB expression requires several controls:

  • Negative controls:

    • Wild-type Marchantia polymorpha (without transformation)

    • Transformants with empty vectors

    • Transformants with non-functional psbB variants (e.g., with critical histidine residues mutated)

  • Positive controls:

    • Constructs with known highly expressed chloroplast genes (e.g., psbA, rbcL)

    • Constructs with reporter genes under control of the same regulatory elements

  • Expression system controls:

    • Comparison of different promoters and 5' UTRs (e.g., constructs with synthetic ribosome binding sequences versus native 5' UTRs)

    • Constructs with mutated PPR binding sites to assess the impact of RNA binding proteins on expression levels

  • Subspecies controls:

    • When working with natural populations, genetic characterization to identify potential introgression events that might affect experimental outcomes

    • Comparison across different Marchantia polymorpha subspecies to account for genetic variation

Including these controls helps distinguish between effects specific to the recombinant psbB and those attributable to the expression system or genetic background.

How can researchers analyze chlorophyll binding sites in CP47?

Analyzing chlorophyll binding sites in CP47 requires specialized techniques that combine structural, biochemical, and computational approaches:

  • Sequence analysis:

    • Identification of conserved histidine residues that potentially coordinate chlorophyll molecules

    • Alignment of CP47 sequences across species to identify highly conserved residues

  • Site-directed mutagenesis:

    • Systematic mutation of potential chlorophyll-binding histidine residues

    • Analysis of chlorophyll content and spectroscopic properties in mutants

  • Spectroscopic techniques:

    • Absorption spectroscopy to characterize bound chlorophylls

    • Circular dichroism to assess changes in protein-pigment interactions

    • Time-resolved fluorescence to evaluate energy transfer processes

  • Structural methods:

    • X-ray crystallography or cryo-electron microscopy of isolated PSII complexes

    • Molecular dynamics simulations to model chlorophyll-protein interactions

Research in cyanobacteria has identified five pairs of histidine residues in CP47 that are spaced by 13 or 14 amino acids and located in hydrophobic regions of the protein, making them prime candidates for chlorophyll binding . Similar conserved residues likely exist in Marchantia polymorpha CP47 and could be targeted for mutational analysis.

What methods can be used to study the interaction between CP47 and other Photosystem II subunits?

Understanding the interactions between CP47 and other PSII subunits requires multiple complementary approaches:

  • Chemical cross-linking combined with mass spectrometry:

    • Using cleavable cross-linkers like dithiobis(sulfosuccinimidylpropionate)

    • Analysis by diagonal electrophoresis followed by immunoblotting or mass spectrometry

  • Co-immunoprecipitation:

    • Pulling down CP47 and identifying interacting partners

    • Reverse co-IP using antibodies against potential interaction partners

  • Yeast two-hybrid or split-GFP assays:

    • For testing specific domain interactions

    • May require modification for membrane proteins

  • Structural techniques:

    • Single-particle cryo-electron microscopy of isolated complexes

    • X-ray crystallography of PSII complexes or subcomplexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.