Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19-like protein (YMF18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YMF18; Putative ATP synthase protein YMF19-like protein; ORF 155
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
YMF18
Target Protein Sequence
MLCRTNVLHLRPQLNKFTYLTQFLWLCLFYITFYFVLYSVLVFTNTEWPFILLKKRLVSQ EKIRAYQSNDCVGQTRGLTSEPSWRDACWRALILAYLTSIYFFPILGSFPRVLKDQVDFG YIPTVCILLYVIFLFFFDSYRKSLFTTALTHSFWL
Uniprot No.

Target Background

Protein Families
ATPase protein YMF19 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Marchantia polymorpha and why is it a valuable model organism for studying ATP synthase proteins?

Marchantia polymorpha is a liverwort that occupies a crucial position in the evolution of land plants, representing one of the earliest diverging lineages of extant land plants. Its value as a model organism stems from several key characteristics that make it ideal for molecular genetics studies . The haploid gametophytic generation is dominant in its life cycle, providing significant advantages over diploid vascular plants for genetic analysis since mutations are immediately expressed without being masked by dominant alleles .

M. polymorpha can reproduce both sexually and asexually through gemmae (bud-like structures), allowing for rapid propagation of isogenic biomass for molecular and biochemical experiments . This feature is particularly valuable when studying membrane proteins like ATP synthases, as it ensures consistency across biological replicates. Furthermore, M. polymorpha possesses a less complex form of many mechanisms found in land plants, making it easier to study fundamental processes without the complications present in more evolved species .

The ongoing genome sequencing projects for M. polymorpha have further enhanced its utility as a model organism, providing the genetic foundation necessary for studying proteins like the YMF19-like protein (YMF18) and understanding their evolutionary significance in the context of land plant adaptation .

How do ATP synthase proteins function in Marchantia polymorpha compared to other plant species?

ATP synthase proteins in M. polymorpha follow the fundamental mechanism of ATP synthesis seen in other organisms but may exhibit specific adaptations reflecting the evolutionary position of liverworts. Based on research on plasma membrane H⁺-ATPase in M. polymorpha, we can infer that ATP synthases likely maintain core functional domains while showing liverwort-specific modifications .

Phylogenetic analysis indicates that some M. polymorpha H⁺-ATPase isoforms cluster with Arabidopsis H⁺-ATPase while others are closer to the non-pT H⁺-ATPase of Chlamydomonas reinhardtii . This distribution suggests that M. polymorpha retained both ancestral and derived forms of ATP synthases, providing a unique window into the evolution of these crucial energy-transducing proteins during the transition to land.

What are the most effective protocols for extracting high-quality RNA from Marchantia polymorpha for studying YMF19-like protein expression?

Extracting high-quality RNA from M. polymorpha requires protocols optimized for its unique biochemical composition, particularly considering the high levels of secondary metabolites like flavonoids and marchantins that can interfere with RNA isolation. Based on research methodologies used in transcriptomic analyses of M. polymorpha, several approaches have proven effective.

When isolating RNA for studying YMF19-like protein expression, researchers should consider that M. polymorpha tissues contain varying levels of phenolic compounds depending on growth conditions. Studies of MpMYB14 and MpMYB02 overexpressors demonstrate that these transcription factors increase the production of riccionidins and marchantins, respectively, which can contaminate RNA preparations . Therefore, RNA extraction protocols should incorporate PVPP (polyvinylpolypyrrolidone) or similar compounds that bind phenolics and prevent their co-purification with nucleic acids.

For transcriptomic analyses, researchers have successfully employed methods that include an initial grinding of tissue in liquid nitrogen followed by extraction with a buffer containing a high concentration of guanidinium thiocyanate, β-mercaptoethanol, and sarkosyl . This approach effectively denatures ribonucleases while disrupting protein-RNA interactions. Subsequent purification steps using silica column-based methods have yielded RNA of sufficient quality for RNA-seq analysis, which has been successfully applied to study transcriptional changes in M. polymorpha under various conditions .

What gene targeting systems are available for studying the function of YMF19-like protein in Marchantia polymorpha?

Several gene targeting systems have been developed for M. polymorpha that can be adapted to study the function of YMF19-like protein. The most established approach employs homologous recombination-mediated gene targeting combined with a positive/negative selection system to reduce non-homologous random integration .

This method utilizes an efficient Agrobacterium-mediated transformation system with M. polymorpha sporelings, achieving homologous recombination in approximately 2% of thalli that pass the positive/negative selection . The system has been validated by successfully knocking out genes such as NOP1, which resulted in impaired air-chamber formation . The haploid nature of the M. polymorpha gametophyte generation provides a significant advantage for this approach, as knockout phenotypes can be directly observed without the need for generating homozygous mutants.

For studying YMF19-like protein, researchers could design targeting vectors containing homology arms flanking the YMF19-like gene sequence, along with selection markers. After transformation and selection, confirmed knockout lines could be subjected to physiological, biochemical, and molecular analyses to determine the role of this ATP synthase protein in M. polymorpha energy metabolism, growth, and stress responses.

More recently, CRISPR/Cas9-based genome editing has been adapted for M. polymorpha, offering an alternative approach for generating targeted mutations in the YMF19-like gene with potentially higher efficiency than traditional homologous recombination methods.

How does the regulation of YMF19-like protein expression change under different environmental stresses in Marchantia polymorpha?

The regulation of M. polymorpha proteins, including ATP synthases like YMF19-like protein, likely involves complex responses to environmental stresses similar to other energy-related proteins. Research on M. polymorpha has shown that environmental stresses significantly alter gene expression and protein regulation patterns, particularly through conserved signaling pathways.

Studies of the plasma membrane H⁺-ATPase in M. polymorpha demonstrate that these energy-transducing proteins are regulated by phosphorylation of the penultimate threonine residue in response to physiological signals such as light, sucrose, and osmotic shock . This regulatory mechanism involves the binding of 14-3-3 proteins to the phosphorylated threonine, similar to the mechanism observed in vascular plants . M. polymorpha expresses a typical 14-3-3 protein (Mp14-3-3a) that binds to phosphorylated H⁺-ATPase in thalli, indicating conservation of this regulatory pathway across land plants .

Environmental stress responses in M. polymorpha also involve transcription factors that may indirectly affect ATP synthase expression. For instance, MYC-related transcription factors in M. polymorpha are functionally conserved with those in Arabidopsis and are involved in activating the jasmonate pathway in response to stress . Additionally, R2R3MYB transcription factors regulate flavonoid production in response to abiotic stresses like light and nutrient deprivation . These stress response pathways likely intersect with the regulation of energy metabolism proteins, including ATP synthases, to coordinate the plant's adaptation to challenging environments.

How do knockout and overexpression of the YMF19-like protein affect energy metabolism in Marchantia polymorpha?

Knockout and overexpression studies of the YMF19-like protein would likely reveal significant effects on energy metabolism in M. polymorpha, though specific studies targeting this protein are not directly reported in the provided search results. Based on methodologies used for other M. polymorpha proteins, researchers can design similar approaches to investigate this ATP synthase component.

For knockout studies, the homologous recombination-mediated gene targeting system described for M. polymorpha provides an efficient approach . Knockout lines would likely exhibit altered ATP production capacity, potentially affecting growth rates, response to energy-demanding stresses, and developmental processes. Careful physiological characterization of these lines, including measurements of ATP/ADP ratios, oxygen consumption rates, and photosynthetic efficiency would quantify the impact on energy metabolism.

Overexpression studies could employ techniques similar to those used for MpMYB14 and MpMYB02, where transgenic lines showed dramatic phenotypic changes related to secondary metabolite production . For the YMF19-like protein, overexpression constructs could be designed using constitutive promoters and transformed into M. polymorpha sporelings using Agrobacterium-mediated transformation. Subsequent analyses would focus on whether increased expression enhances ATP production capacity, alters proton gradients across membranes, or affects the plant's ability to respond to fluctuating energy demands.

Complementary approaches such as metabolomics and transcriptomics, similar to those employed for studying MpMYB overexpressors , would provide comprehensive insights into how alterations in YMF19-like protein levels ripple through the metabolic network of M. polymorpha.

What are the structural differences between recombinant YMF19-like protein produced in E. coli versus native protein in Marchantia polymorpha?

Recombinant expression of M. polymorpha proteins in E. coli may introduce structural differences compared to the native forms due to several factors related to the distinct cellular environments and post-translational modification capabilities of these evolutionarily distant organisms.

When expressing M. polymorpha YMF19-like protein in E. coli, researchers should consider that bacterial systems lack many of the post-translational modification mechanisms present in eukaryotes. Studies on M. polymorpha H⁺-ATPase have shown that regulatory phosphorylation of the penultimate threonine residue creates a binding motif for 14-3-3 proteins, which is crucial for function . If similar modifications are necessary for YMF19-like protein function, the recombinant protein from E. coli would lack these modifications.

Structural analysis techniques such as circular dichroism spectroscopy, thermal shift assays, and limited proteolysis can be employed to compare the folding and stability of recombinant versus native YMF19-like protein. For more detailed structural comparison, X-ray crystallography or cryo-electron microscopy could reveal atomic-level differences. Additionally, functional assays measuring ATP synthase activity would determine whether the recombinant protein retains the catalytic capabilities of the native form.

To address potential structural discrepancies, researchers might consider alternative expression systems closer to plant cells, such as microalgae or plant-based transient expression systems, which may provide a more suitable environment for proper folding and modification of M. polymorpha proteins.

What are the optimal conditions for expressing recombinant YMF19-like protein in heterologous systems?

Optimizing heterologous expression of M. polymorpha YMF19-like protein requires careful consideration of expression systems, protein characteristics, and purification strategies. Based on approaches used for other plant proteins, several strategies can be recommended.

For prokaryotic expression, E. coli remains the most accessible system, but researchers should consider using strains engineered for membrane protein expression (e.g., C41/C43) if YMF19-like protein contains transmembrane domains. Codon optimization based on M. polymorpha codon usage patterns is essential, as significant differences exist between liverwort and bacterial codon preferences. Lower induction temperatures (15-20°C) and reduced inducer concentrations often improve folding of plant proteins in bacterial systems by slowing expression and allowing time for proper membrane insertion or folding.

Eukaryotic expression systems may provide advantages for YMF19-like protein production. Yeast systems (Pichia pastoris or Saccharomyces cerevisiae) offer a eukaryotic environment with capabilities for some post-translational modifications. Plant-based expression systems, such as Nicotiana benthamiana transient expression via Agrobacterium infiltration, provide a more native-like environment for M. polymorpha proteins.

Purification strategies should incorporate detergents suitable for ATP synthase components if YMF19-like protein is membrane-associated. Techniques such as affinity chromatography using polyhistidine tags, followed by size exclusion chromatography in the presence of appropriate detergents or lipid nanodiscs, have proven successful for other ATP synthase components and could be adapted for the YMF19-like protein.

How can researchers effectively design experiments to study the evolutionary conservation of YMF19-like protein across bryophytes?

Designing experiments to study the evolutionary conservation of YMF19-like protein across bryophytes requires a multifaceted approach combining phylogenetic analysis, functional complementation, and structural biology. This experimental design would provide insights into how this ATP synthase component evolved during land plant diversification.

The first step involves comprehensive phylogenetic analysis of YMF19-like protein sequences from diverse bryophytes, charophycean algae, and vascular plants. This approach, similar to the analysis of MYC-related transcription factors that revealed their conservation between M. polymorpha and Arabidopsis , would establish the evolutionary trajectory of this ATP synthase component. Phylogenetic analysis should include assessment of selection pressures acting on different protein domains to identify conserved functional regions versus rapidly evolving regions.

Functional complementation experiments could test whether YMF19-like proteins from different bryophyte lineages can rescue phenotypes of M. polymorpha YMF19-like protein knockout mutants. This approach would determine whether functional conservation extends beyond sequence similarity. The gene targeting systems established for M. polymorpha provide the foundation for generating knockout lines for such complementation studies.

Structural studies comparing the three-dimensional organization of YMF19-like proteins from different bryophyte lineages, perhaps using cryo-electron microscopy or X-ray crystallography, would reveal how structural features have been conserved despite sequence divergence. These structural insights, combined with site-directed mutagenesis targeting conserved residues, would identify critical functional domains maintained throughout bryophyte evolution.

What methodologies are most effective for analyzing the impact of YMF19-like protein phosphorylation on ATP synthase function?

Analyzing the impact of phosphorylation on YMF19-like protein function requires a combination of biochemical, molecular, and physiological approaches. Based on studies of H⁺-ATPase regulation in M. polymorpha, several methodologies can be adapted for investigating phosphorylation of YMF19-like protein.

Initial identification of potential phosphorylation sites could employ in silico prediction tools followed by phosphoproteomic analysis using mass spectrometry. Research on M. polymorpha H⁺-ATPase has shown that phosphorylation of the penultimate threonine residue creates a binding site for 14-3-3 proteins , suggesting similar regulatory mechanisms might exist for YMF19-like protein.

Site-directed mutagenesis could then be used to create phosphomimetic (e.g., serine/threonine to aspartate) and phosphonull (serine/threonine to alanine) variants of YMF19-like protein at identified phosphorylation sites. These variants could be expressed in YMF19-like protein knockout M. polymorpha lines using the established transformation systems to assess the physiological impact of phosphorylation status.

Biochemical approaches to directly measure the effect of phosphorylation on ATP synthase activity could include reconstitution of purified proteins in liposomes or nanodiscs, allowing measurement of ATP synthesis rates or proton translocation efficiency. Additionally, protein-protein interaction studies using techniques like co-immunoprecipitation would reveal how phosphorylation affects the assembly of YMF19-like protein into the complete ATP synthase complex, potentially identifying phosphorylation-dependent interaction partners.

What are the most reliable methods for quantifying YMF19-like protein expression levels in different tissues and developmental stages of Marchantia polymorpha?

Reliable quantification of YMF19-like protein expression requires a combination of transcriptomic and proteomic approaches, each with specific advantages for addressing different aspects of gene expression regulation. Based on methodologies applied to study other M. polymorpha genes, several approaches can be recommended.

At the transcript level, quantitative real-time PCR (qRT-PCR) provides a targeted, sensitive method for measuring YMF19-like gene expression. This approach has been successfully used to confirm expression of genes like Mp14-3-3a in M. polymorpha thalli . For broader transcriptomic analysis, RNA-seq has been employed to study differential gene expression in M. polymorpha under various conditions, including in overexpressors of transcription factors . RNA-seq would place YMF19-like protein expression in the context of global transcriptional programs across tissues and developmental stages.

At the protein level, western blotting using specific antibodies against the YMF19-like protein provides direct quantification of protein abundance. If antibodies are unavailable, epitope tagging approaches could be employed by creating transgenic M. polymorpha lines expressing tagged versions of the YMF19-like protein under its native promoter . For more comprehensive analysis, proteomics approaches using liquid chromatography-tandem mass spectrometry (LC-MS/MS) would allow quantification of YMF19-like protein alongside the entire M. polymorpha proteome.

Tissue-specific expression patterns could be visualized using reporter gene constructs, where the YMF19-like protein promoter drives expression of fluorescent proteins. This approach would reveal spatial expression patterns across different tissues and developmental stages, complementing the quantitative data from qRT-PCR and proteomics.

How can researchers resolve contradictory results between transcript and protein levels of YMF19-like protein in Marchantia polymorpha?

Contradictions between transcript and protein levels of YMF19-like protein may arise from various post-transcriptional and post-translational regulatory mechanisms. Resolving such discrepancies requires systematic investigation of the factors influencing gene expression at different levels.

First, researchers should validate their measurement techniques to ensure that observed discrepancies are not artifacts of the methods used. For transcript measurements, multiple reference genes should be employed for qRT-PCR normalization, with careful primer design to ensure specificity for the YMF19-like gene. For protein measurements, antibody specificity should be confirmed using knockout lines as negative controls, and multiple normalization strategies should be compared.

Post-transcriptional regulation, including mRNA stability, alternative splicing, and translational efficiency, could explain discrepancies between transcript and protein levels. RNA-seq analysis can identify alternative splice variants of YMF19-like transcripts, while polysome profiling would reveal whether transcripts are efficiently translated. mRNA half-life measurements using transcription inhibitors would determine whether differential mRNA stability contributes to the observed discrepancies.

Post-translational mechanisms, including protein stability and degradation rates, should also be investigated. Pulse-chase experiments using metabolic labeling could measure the half-life of YMF19-like protein under different conditions. Inhibitors of protein degradation pathways (proteasome, autophagy) would reveal which degradation mechanisms might regulate YMF19-like protein levels independently of transcription.

Finally, time-course experiments measuring both transcript and protein levels following environmental changes or developmental transitions would reveal temporal relationships, determining whether discrepancies reflect time delays between transcription and translation or actively regulated disparities.

What statistical approaches are most appropriate for analyzing differential expression of YMF19-like protein across experimental conditions?

Statistical analysis of YMF19-like protein differential expression requires approaches tailored to the specific data types and experimental designs employed. Based on methodologies used in M. polymorpha transcriptomic and proteomic studies, several statistical frameworks can be recommended.

For RNA-seq data analysis, researchers studying M. polymorpha have successfully employed packages such as DESeq2 or edgeR, which utilize negative binomial models appropriate for count data . These approaches incorporate biological variability and account for the mean-variance relationship characteristic of RNA-seq data. When analyzing YMF19-like gene expression across multiple conditions, researchers should implement multiple testing correction (e.g., Benjamini-Hochberg procedure) to control false discovery rates.

For proteomic data, quantitative approaches such as label-free quantification or isobaric tagging (TMT/iTRAQ) generate data with different statistical properties than RNA-seq. Linear models implemented in packages like limma (with appropriate transformations) or specialized proteomic analysis tools like MSstats provide robust statistical frameworks for analyzing these data. Normalization strategies should account for technical variations inherent to mass spectrometry-based proteomics.

When integrating transcript and protein data to resolve discrepancies, multivariate statistical approaches such as principal component analysis, partial least squares, or canonical correlation analysis can identify patterns of co-regulation and divergence across molecular levels. These approaches could reveal whether YMF19-like protein regulation clusters with specific functional categories of genes/proteins under various conditions.

For time-course experiments, statistical approaches that account for temporal correlation, such as functional data analysis or mixed-effect models with time as a random effect, provide more power than treating each time point as an independent condition.

How should researchers interpret the evolutionary significance of YMF19-like protein conservation between Marchantia polymorpha and other plant lineages?

Interpreting the evolutionary significance of YMF19-like protein conservation requires integration of phylogenetic, structural, and functional data within the broader context of land plant evolution. Several analytical frameworks can guide this interpretation.

Phylogenetic analyses should first establish whether YMF19-like protein represents an ancestral or derived feature in land plants. Research on MYC-related transcription factors in M. polymorpha suggests that some regulatory functions first appeared in charophycean algae and predate the evolutionary appearance of other pathway components . Similar analysis of YMF19-like protein would determine whether it represents a core component of early land plant ATP synthases or a liverwort-specific innovation.

Comparative analyses of selective pressures using approaches like dN/dS ratio calculations across protein domains would identify regions under purifying selection (highly conserved, functionally constrained) versus diversifying selection (potentially involved in lineage-specific adaptations). This approach could reveal whether different functional domains of YMF19-like protein experienced distinct evolutionary trajectories during land plant diversification.

Structural bioinformatics approaches comparing predicted protein structures across lineages would complement sequence-based analyses, as structural conservation often exceeds sequence conservation for functionally important proteins. Analysis of co-evolution patterns between YMF19-like protein and other ATP synthase components could reveal evolutionary constraints imposed by protein-protein interactions within this complex.

Functional studies in heterologous systems could test whether YMF19-like proteins from different plant lineages can functionally substitute for each other, similar to the demonstrated functional conservation of MYC-related transcription factors between Arabidopsis and M. polymorpha despite 450 million years of independent evolution .

What considerations are important when comparing results from different expression systems for recombinant YMF19-like protein production?

When comparing results from different expression systems for recombinant YMF19-like protein, researchers must carefully consider several factors that influence protein yield, structure, and function. These considerations ensure valid comparisons and inform the selection of optimal systems for specific research objectives.

Expression yield comparisons should account for differences in growth conditions, induction parameters, and protein extraction efficiencies across systems. Quantification methods should be standardized, ideally using absolute quantification approaches rather than relative comparisons. Researchers should report yields in terms of protein amount per unit biomass (mg/g wet weight) or per culture volume (mg/L) to facilitate meaningful comparisons.

Structural integrity assessments are crucial when comparing proteins from different expression systems. Techniques such as circular dichroism spectroscopy, size exclusion chromatography, and thermal shift assays can reveal differences in folding, stability, and aggregation propensity. If YMF19-like protein forms part of a multi-subunit complex, assembly competence should be evaluated through co-immunoprecipitation or analytical ultracentrifugation.

Post-translational modifications vary significantly across expression systems. While E. coli lacks most eukaryotic modifications, yeast systems provide some modification capabilities, and plant-based systems offer the most native-like modification patterns. Mass spectrometry-based proteomics can identify and quantify modifications such as phosphorylation, which may be crucial for YMF19-like protein function based on the regulatory phosphorylation observed for other M. polymorpha proteins .

Functional comparisons should employ standardized assays under identical conditions to measure ATP synthase activity, such as ATP production rates, proton translocation efficiency, or binding affinities for interaction partners. These functional data, combined with structural analyses, would determine whether differences in expression systems translate to meaningful functional differences in the recombinant YMF19-like protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.