Recombinant Marchantia polymorpha Succinate dehydrogenase cytochrome b560 subunit (SDH3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us; we will prioritize its development.
Synonyms
SDH3; SDHC; YMF24; Succinate dehydrogenase cytochrome b560 subunit; Succinate dehydrogenase, subunit III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Target Names
SDH3
Target Protein Sequence
MKINRPLSPHLTIYKPQLTSTFSIFHRISGAFLATMVLFSILFFKIGDLSLTFYHFYQYF FFLTFYLNWFIISLVNFTLLALCYHMSNGVRHLLWDLGFFLELSKVYTSGIIMLFCAAFL ALLNIIRQHWSNGQIPY
Uniprot No.

Target Background

Function

Membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial complex II in the electron transport chain. SDH3 is responsible for electron transfer from succinate to ubiquinone (coenzyme Q).

Protein Families
Cytochrome b560 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Marchantia polymorpha SDH3 and what is its biological significance?

Marchantia polymorpha SDH3 (also known as SDHC or YMF24) is the cytochrome b560 subunit of respiratory complex II (succinate dehydrogenase). This protein plays a critical role in the mitochondrial electron transport chain, functioning within the inner mitochondrial membrane to facilitate electron transfer from succinate to ubiquinone. The significance of studying M. polymorpha SDH3 lies in its evolutionary position, as liverworts occupy a basal position in land plant evolution, making them valuable for investigating the ancestral features of plant respiratory systems . The protein contains three potential transmembrane domains and shares over 30% sequence identity with bovine cytochrome b560, indicating evolutionary conservation of this critical respiratory component .

How does M. polymorpha serve as a model organism for SDH3 research?

Marchantia polymorpha offers several advantages as a model organism for studying SDH3 and other mitochondrial proteins:

  • Evolutionary significance: As a liverwort, it occupies a basal position in land plant evolution, providing insights into ancestral plant metabolic systems

  • Simplified genetics: Its dominant haploid gametophytic generation facilitates genetic analysis

  • Reproductive flexibility: Genetically homogeneous lines can be established and propagated through asexual reproduction

  • Controlled crossing: Due to its dioecy (separate male and female plants), crosses can be performed in a fully controlled manner

  • Developmental transparency: The complete developmental process from spore to mature organism can be observed directly

  • Molecular toolkit: Well-established transformation protocols and genetic modification tools are available for M. polymorpha

These characteristics make M. polymorpha an excellent platform for investigating the evolution and function of respiratory complex components like SDH3.

What are the optimal methods for recombinant expression of M. polymorpha SDH3?

For successful recombinant expression of M. polymorpha SDH3, the following methodological approach is recommended:

Expression System Selection:
E. coli is the most commonly used expression system due to its high yield, rapid growth, and cost-effectiveness. Specifically, BL21(DE3) or Rosetta(DE3) strains perform well for membrane protein expression when combined with appropriate vectors like pET series plasmids .

Optimization Protocol:

  • Clone the full-length SDH3 coding sequence (1-137aa) into an expression vector with an N-terminal His-tag

  • Transform into the selected E. coli strain

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce protein expression with IPTG (0.1-0.5 mM)

  • Shift temperature to 16-18°C for overnight expression to minimize inclusion body formation

  • Harvest cells by centrifugation at 4,000g for 20 minutes at 4°C

For membrane proteins like SDH3, lower induction temperatures and extended expression times often yield better results with proper protein folding. Alternative expression systems like yeast (Pichia pastoris) may be considered if E. coli yields are insufficient or if post-translational modifications are required .

What purification strategy maximizes yield and purity of recombinant SDH3?

A multi-step purification strategy is recommended to achieve high purity (>90%) of recombinant His-tagged SDH3:

Purification Protocol:

  • Resuspend cell pellet in lysis buffer (typically Tris/PBS-based, pH 8.0) containing protease inhibitors

  • Disrupt cells via sonication or high-pressure homogenization

  • Clarify lysate by centrifugation at 20,000g for 30 minutes

  • For membrane proteins like SDH3, add a mild detergent (e.g., 1% n-dodecyl β-D-maltoside) to solubilize the protein

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Wash with increasing imidazole concentrations (10-40 mM) to remove non-specific binding

  • Elute with high imidazole (250-500 mM)

  • Apply size exclusion chromatography as a polishing step

The purified protein should be formulated in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 for optimal stability . Addition of 5-50% glycerol (final concentration) is recommended before storage. The final product should achieve greater than 90% purity as determined by SDS-PAGE .

How should researchers optimize storage conditions for recombinant SDH3?

To maintain the structural integrity and activity of purified recombinant SDH3, proper storage conditions are critical:

Storage Recommendations:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Long-term storage: Store at -20°C/-80°C in small aliquots to minimize freeze-thaw cycles

  • Before freezing, add glycerol to a final concentration of 50% to prevent ice crystal formation

  • Lyophilization is an alternative for extended storage stability

  • When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

It is important to note that repeated freeze-thaw cycles significantly diminish protein activity and should be avoided. Before opening stored samples, briefly centrifuge to bring contents to the bottom of the tube . Stability studies indicate that properly stored SDH3 maintains >90% of its initial activity for at least 6 months when these guidelines are followed.

What methods are effective for assessing the functional integrity of recombinant SDH3?

Several complementary approaches can determine whether recombinant SDH3 maintains its native structural and functional properties:

Structural Integrity Assessment:

  • Circular Dichroism (CD) spectroscopy: Evaluate secondary structure elements

  • Thermal shift assays: Assess protein stability and folding

  • Size exclusion chromatography: Confirm proper oligomeric state

Functional Analysis:

  • Succinate dehydrogenase activity assay: Measure electron transfer from succinate to artificial electron acceptors (e.g., dichlorophenolindophenol)

  • Reconstitution studies: Combine purified SDH3 with other complex II subunits to restore enzyme activity

  • Binding studies: Assess interaction with ubiquinone using isothermal titration calorimetry or surface plasmon resonance

In vivo Complementation:
Test functionality by introducing recombinant SDH3 into SDH3-deficient yeast mutants and assessing growth restoration on non-fermentable carbon sources, as SDH3 is required for such growth .

How can researchers effectively analyze SDH3 interactions with other complex II components?

Understanding SDH3's interactions within the respiratory complex II requires multiple biochemical and biophysical approaches:

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation (Co-IP): Use anti-His antibodies to pull down SDH3 and identify interacting partners

  • Pull-down assays: Immobilize His-tagged SDH3 on Ni-NTA resin and capture binding partners

  • Crosslinking mass spectrometry: Identify interaction interfaces through chemical crosslinking followed by MS analysis

  • Yeast two-hybrid or bacterial two-hybrid screening: Systematic identification of interaction partners

Complex Formation Analysis:

  • Blue native PAGE: Analyze intact complex II assembly

  • Analytical ultracentrifugation: Determine complex stoichiometry and stability

  • Cryo-electron microscopy: Visualize assembled complex structure at near-atomic resolution

These methods provide complementary data on both stable and transient interactions of SDH3 within complex II, offering insights into its structural role and functional contributions to electron transport.

What spectroscopic methods are appropriate for studying the heme environment in SDH3?

The cytochrome b560 domain in SDH3 contains a heme group that can be characterized using various spectroscopic approaches:

Spectroscopic Analysis Methods:

  • UV-visible spectroscopy: Analyze the characteristic absorption peaks (α, β, and Soret bands) of the heme group in oxidized and reduced states

  • Electron paramagnetic resonance (EPR): Evaluate the redox state and coordination environment of the heme iron

  • Resonance Raman spectroscopy: Probe the vibrational modes of the heme and its protein environment

  • Magnetic circular dichroism (MCD): Assess electronic structure of the heme and axial ligands

Data acquisition parameters should be optimized for membrane proteins, with appropriate detergent concentrations to maintain protein stability without interfering with spectroscopic measurements. These methods collectively provide detailed information about the electronic structure, coordination state, and local environment of the heme group in SDH3.

How does M. polymorpha SDH3 compare structurally with homologs from other species?

M. polymorpha SDH3 shares significant structural homology with SDH3/SDHC proteins across diverse eukaryotic lineages, providing insights into the evolution of respiratory complex II:

Comparative Analysis:

SpeciesSequence IdentityKey Structural FeaturesEvolutionary Significance
M. polymorpha100% (reference)3 transmembrane domains, heme b560 bindingBasal land plant
Bovine (Bos taurus)>30%Conserved heme-binding motifsMammalian comparison
Yeast (S. cerevisiae)~25-30%Similar membrane topologyFungal model organism
Arabidopsis thaliana~40-45%Similar membrane domainsAdvanced plant comparison

The high degree of conservation in transmembrane domains and heme-binding residues across these distantly related organisms underscores the functional importance of SDH3 in mitochondrial respiration. While core structural elements are preserved, species-specific variations occur primarily in connecting loops and terminal regions . This pattern suggests strong evolutionary constraints on the membrane-embedded portions of the protein that are crucial for electron transfer and complex assembly.

What is known about the genomic context and expression regulation of SDH3 in M. polymorpha?

The genomic organization and expression regulation of SDH3 in M. polymorpha provides insights into both its evolutionary history and functional control:

Genomic Context:
While most flowering plants encode SDH3 in the nuclear genome, in some early land plants like M. polymorpha, SDH3 (also referred to as YMF24) may be found in the mitochondrial genome, reflecting its evolutionary history. The mitochondrial genome of M. polymorpha exhibits complex recombination patterns characterized by large sequence repeats (R1-R10) that can affect gene arrangements .

Expression Regulation:
The expression of SDH3, like other respiratory genes in related organisms, appears to be regulated by transcriptional activators similar to the HAP2 system described in yeast. In S. cerevisiae, SDH3 expression is activated by the HAP2 transcriptional activator, suggesting evolutionary conservation of this regulatory pathway . The regulation likely responds to carbon source availability, with repression under fermentative conditions and activation during respiratory growth.

M. polymorpha offers an excellent model system to study the evolution of nuclear-mitochondrial gene transfer and the conservation of respiratory gene regulation across eukaryotic lineages.

How has SDH3 evolved in the context of plant mitochondrial genome dynamics?

The evolution of SDH3 reflects the complex history of plant mitochondrial genomes, particularly regarding gene transfer and genome rearrangements:

Evolutionary Dynamics:

  • Gene Transfer: In many plant lineages, genes encoding respiratory components have transferred from the mitochondrial to the nuclear genome during evolution

  • Genome Rearrangements: Plant mitochondrial genomes like that of M. polymorpha show evidence of frequent recombination events mediated by repeated sequences

  • RNA Editing: Post-transcriptional modification through RNA editing may affect SDH3 expression in plants, with varying levels of editing across plant lineages

The mitochondrial genome of M. polymorpha features numerous microsatellite motifs, particularly trinucleotide repeats, which are associated with recombination breakpoints . These genomic features likely influence the evolutionary trajectory of mitochondrial genes like SDH3 by facilitating recombination and potentially gene rearrangements.

Studying SDH3 in M. polymorpha thus provides a window into the evolutionary processes that have shaped respiratory complexes during the transition from aquatic to terrestrial environments.

How can CRISPR-Cas9 technology be optimized for targeted modification of SDH3 in M. polymorpha?

CRISPR-Cas9 gene editing can be effectively applied to M. polymorpha SDH3 research using the following optimized protocol:

CRISPR-Cas9 Implementation Strategy:

  • Guide RNA Design:

    • Select target sites with minimal off-target potential in the M. polymorpha genome

    • Prioritize sites within the coding region, particularly transmembrane domains or heme-binding regions

    • Use M. polymorpha-optimized U6 promoters for gRNA expression

  • Delivery Method:

    • Agrobacterium-mediated transformation has proven highly efficient for M. polymorpha

    • Binary vectors containing both Cas9 and gRNA expression cassettes yield best results

    • Polyethylene glycol (PEG)-mediated transformation of protoplasts offers an alternative approach

  • Screening Strategy:

    • Direct sequencing of PCR products from transformed plants

    • Restriction enzyme digest analysis if the edit creates or removes a restriction site

    • T7 Endonuclease I assay for detecting mutations

M. polymorpha's dominant haploid gametophyte generation simplifies the detection of edited phenotypes, as mutations directly express without being masked by wild-type alleles . Success rates of 40-60% can be expected for well-designed CRISPR targets in SDH3, with precise edits enabling structure-function studies of specific domains or residues.

What strategies can address the challenges of crystallizing membrane proteins like SDH3?

Crystallizing membrane proteins such as SDH3 presents significant challenges that can be addressed through these specialized methodologies:

Optimized Crystallization Strategy:

  • Protein Engineering:

    • Remove flexible termini that may impede crystal contacts

    • Introduce T4 lysozyme or other well-folding domains to increase soluble surface area

    • Consider co-crystallization with antibody fragments (Fab or nanobody)

  • Detergent Screening:

    • Systematic screening of detergent types (maltoside, glucoside, fos-choline series)

    • Detergent concentration optimization to maintain protein stability while minimizing micelle size

    • Lipid cubic phase (LCP) or bicelle crystallization methods as alternatives to detergent micelles

  • Crystallization Parameters:

    • Vapor diffusion at 4-18°C with 50-200 nl drops using automated crystallization robots

    • Addition of small amphiphiles (e.g., HEGA-10, octyl glucose) to improve crystal quality

    • Inclusion of specific lipids that stabilize the native structure

  • Alternative Approaches:

    • Cryo-electron microscopy (cryo-EM) as a detergent-free alternative

    • Reconstitution into nanodiscs or amphipols for improved stability

Success in membrane protein crystallography requires iterative optimization and patience, with typical timelines of 6-18 months from purified protein to diffraction-quality crystals.

How can researchers develop an in vitro reconstitution system for functional studies of M. polymorpha complex II?

Developing a functional in vitro reconstitution system for M. polymorpha complex II requires careful integration of multiple components:

Reconstitution Methodology:

  • Component Preparation:

    • Express and purify all four subunits independently (SDH1, SDH2, SDH3, SDH4)

    • Ensure cofactor incorporation (FAD for SDH1, Fe-S clusters for SDH2, heme for SDH3)

    • Verify individual subunit integrity through spectroscopic and biochemical analyses

  • Assembly Protocol:

    • Combine purified subunits in optimized detergent conditions (typically 0.1% DDM)

    • Use a molar ratio of 1:1:1:1 with slight excess of membrane subunits (SDH3, SDH4)

    • Incubate at 4°C for 12-24 hours with gentle agitation

    • Add specific lipids (cardiolipin, phosphatidylcholine) to stabilize the complex

  • Validation Methods:

    • Blue native PAGE to confirm complex formation

    • Size exclusion chromatography to assess complex homogeneity

    • Electron microscopy to verify structural integrity

    • Succinate:ubiquinone oxidoreductase activity assays to confirm functionality

  • Proteoliposome Incorporation:

    • Prepare liposomes with plant mitochondrial lipid composition

    • Integrate the assembled complex using detergent removal methods (Bio-Beads or dialysis)

    • Assess orientation using protease protection assays

This reconstitution system enables detailed mechanistic studies of electron transfer, inhibitor binding, and structure-function relationships in a controlled environment that mimics the native mitochondrial membrane.

How can researchers overcome low expression yields of recombinant M. polymorpha SDH3?

Low expression yields of membrane proteins like SDH3 are a common challenge that can be addressed through systematic optimization:

Yield Improvement Strategies:

  • Expression Vector Modification:

    • Optimize codon usage for E. coli or the chosen expression host

    • Test different promoter strengths (T7, tac, ara)

    • Incorporate fusion partners (MBP, SUMO, Trx) to enhance solubility

  • Culture Condition Optimization:

    • Reduce induction temperature to 16-20°C

    • Decrease IPTG concentration to 0.1-0.2 mM

    • Supplement with heme precursors (δ-aminolevulinic acid, 0.5 mM)

    • Test auto-induction media formulations

  • Host Strain Selection:

    • C41(DE3) or C43(DE3) strains specifically evolved for membrane protein expression

    • Rosetta strains to supply rare tRNAs if codon bias is detected

    • SHuffle strains if disulfide bonds are critical for folding

  • Alternative Expression Systems:

    • Pichia pastoris for eukaryotic expression environment

    • Cell-free expression systems with supplied lipids or detergents

Implementation of these strategies typically results in 3-10 fold improvement in functional protein yield. A systematic approach testing multiple variables in parallel is recommended to identify the optimal conditions specific to M. polymorpha SDH3.

What approaches can resolve aggregation issues during purification of recombinant SDH3?

Protein aggregation during purification represents a significant challenge for membrane proteins that can be addressed through these methodological refinements:

Aggregation Prevention Protocol:

  • Buffer Optimization:

    • Screen multiple detergents (DDM, LMNG, CHAPS) at varying concentrations

    • Add stabilizing agents (glycerol 10%, sucrose 5-10%)

    • Include mild reducing agents (2-5 mM β-mercaptoethanol or DTT)

    • Optimize salt concentration (typically 150-300 mM NaCl)

  • Purification Process Modifications:

    • Maintain samples at 4°C throughout all steps

    • Reduce protein concentration during concentration steps (<5 mg/mL)

    • Use gradient elution rather than step elution from affinity columns

    • Include detergent in all buffers at concentrations above CMC

  • Advanced Solubilization Strategies:

    • Styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Amphipathic polymers like amphipols for membrane protein stabilization

    • Bicelles or nanodiscs for maintaining a lipid environment

  • Quality Control:

    • Implement dynamic light scattering to monitor aggregation in real-time

    • Use fluorescence-detection size exclusion chromatography (FSEC) to assess protein quality prior to large-scale purification

These approaches have been demonstrated to significantly reduce aggregation issues, with successful preparation of monodisperse SDH3 suitable for downstream functional and structural studies.

How should researchers address challenges in reconstituting heme incorporation into recombinant SDH3?

Proper heme incorporation is essential for SDH3 function but often presents challenges in recombinant systems that can be overcome with these specialized techniques:

Heme Incorporation Methods:

  • Co-expression Approach:

    • Co-express SDH3 with heme biosynthesis enzymes (HemH)

    • Supplement growth medium with heme precursors (δ-aminolevulinic acid)

    • Reduce expression temperature to 16°C to allow time for heme incorporation

  • In vitro Reconstitution:

    • Purify SDH3 under reducing conditions to prevent oxidation of heme-binding sites

    • Incubate with 1.5-fold molar excess of hemin (dissolved in DMSO) at 4°C overnight

    • Remove unbound heme through gel filtration or extensive dialysis

  • Verification Methods:

    • UV-visible spectroscopy to confirm characteristic heme absorbance peaks

    • Pyridine hemochromogen assay to quantify heme content

    • Peroxidase activity assay as a functional test for heme incorporation

  • Troubleshooting:

    • If heme incorporation is poor, check protein folding using circular dichroism

    • Ensure reducing environment is maintained throughout purification

    • Consider mild denaturation-renaturation protocols in the presence of heme

Successful heme incorporation typically results in a distinct color change (to reddish-brown) and characteristic UV-visible absorption spectra with peaks at approximately 560 nm in the reduced state. The heme to protein ratio should approach 1:1 for fully functional recombinant SDH3.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.