Recombinant Maricaulis maris ATP synthase subunit b 1 (atpF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF1; Mmar10_2203; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Maricaulis maris (strain MCS10)
Target Names
atpF1
Target Protein Sequence
MTHAPHSEVAQHVAEAAADHADSGVFPPFDPTYFASQLFWLTIAFVILYIALDRLILPKI KTTIEDRRDRIADDLDAAAQAKADAEAAGEAYEKSLAEARNKAHALAAKTRQTLDAEIAK ETAAVEAELSAKQEASEAAIRKAKDKAFAEVRGIAATATAAVVSALAGVEVSEADAGKTV DGLIKAKEA
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, containing the extramembraneous catalytic core, and F0, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of ATP synthase subunit b 1 in Maricaulis maris?

ATP synthase subunit b 1 (atpF1) in Maricaulis maris functions as a critical component of the F₀ portion of the F₁F₀ ATP synthase complex. This subunit contributes to the structural stability of the complex by forming part of the peripheral stalk that connects the F₁ and F₀ domains. The peripheral stalk prevents rotation of the F₁ sector during ATP synthesis, allowing the central stalk to rotate within the F₁ head to drive ATP production. This functional arrangement is similar to what has been observed in ATP synthase complexes across different species, where subunit organization is crucial for proper enzymatic activity .

What are the structural characteristics of Maricaulis maris ATP synthase subunit b 1?

Maricaulis maris ATP synthase subunit b 1 has a predominantly alpha-helical structure, particularly in its C-terminal domain that interacts with F₁. The protein features a hydrophobic N-terminal region that anchors it to the membrane, followed by a hydrophilic portion that extends from the membrane to interact with other subunits. This structural arrangement allows subunit b 1 to function as part of the peripheral stalk that connects the F₀ and F₁ sectors of ATP synthase. The specific amino acid sequence of Maricaulis maris atpF1 contains several conserved regions that are crucial for interactions with other ATP synthase subunits, including binding sites for the delta and alpha subunits of the F₁ sector .

How is atpF1 expression regulated in Maricaulis maris?

Based on studies of ATP synthase in other organisms, atpF1 expression is likely regulated through mechanisms similar to those observed for other ATP synthase subunits. Research on yeast mitochondria has demonstrated that the expression of some ATP synthase subunits, such as Atp6p and Atp8p, is translationally regulated by the presence of F₁ components or assembly intermediates . This suggests a potential feedback mechanism where the assembly state of the F₁ sector influences the expression of other ATP synthase components. In Maricaulis maris, specific regulatory elements in the promoter region of the atpF1 gene likely control its transcription in response to cellular energy demands and environmental conditions .

What are the most effective methods for expressing recombinant Maricaulis maris atpF1?

For optimal expression of recombinant Maricaulis maris atpF1, a methodological approach similar to that used for other ATP synthase subunits is recommended:

  • Expression System Selection: E. coli BL21(DE3) or similar strains are often preferred for recombinant expression of bacterial proteins. For membrane proteins like atpF1, specialized strains such as C41(DE3) or C43(DE3) may provide better expression yields.

  • Vector Design: Incorporate a strong inducible promoter (T7 or tac) and appropriate fusion tags to facilitate purification. Common tags include His₆, GST, or MBP, with TEV or PreScission protease cleavage sites for tag removal.

  • Expression Conditions: Optimize induction parameters including temperature (typically lowered to 16-20°C), inducer concentration, and duration to maximize soluble protein yield.

  • Solubilization Strategy: For membrane-associated proteins like atpF1, include appropriate detergents (DDM, LDAO, or Triton X-100) in the lysis buffer to effectively solubilize the protein from membranes .

What purification strategies yield the highest purity and activity of recombinant atpF1?

A multi-step purification strategy is recommended to achieve high purity and preserve the activity of recombinant atpF1:

  • Initial Capture: Affinity chromatography based on the fusion tag (e.g., IMAC for His-tagged proteins)

  • Intermediate Purification: Ion exchange chromatography to separate based on charge differences

  • Polishing: Size exclusion chromatography to achieve final purity and buffer exchange

Recommended Purification Protocol:

StepMethodBuffer CompositionKey Parameters
1Affinity (Ni-NTA)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% DDM, 5-250 mM imidazole gradientFlow rate: 1 ml/min, Collect 1-2 ml fractions
2Ion Exchange20 mM HEPES pH 7.5, 50-500 mM NaCl gradient, 0.03% DDMpH adjusted to theoretical pI ± 1 unit
3Size Exclusion20 mM HEPES pH 7.5, 150 mM NaCl, 0.02% DDM, 5% glycerolRun at 0.5 ml/min, monitor A280

The final purified protein should be assessed by SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity. Detergent concentration should be maintained above the critical micelle concentration throughout purification to prevent protein aggregation .

How can I assess the functional activity of purified recombinant atpF1?

To evaluate the functional activity of purified recombinant atpF1, several complementary approaches can be employed:

  • Binding Assays: Use surface plasmon resonance (SPR) or microscale thermophoresis (MST) to measure binding affinities between atpF1 and other ATP synthase subunits, particularly those it interacts with in the native complex.

  • Structural Integrity Analysis: Employ circular dichroism (CD) spectroscopy to assess secondary structure content and thermal stability. This can be compared to theoretical predictions based on sequence analysis.

  • Assembly Assays: Reconstitution experiments with other purified ATP synthase subunits to assess the ability of atpF1 to form higher-order structures. This can be monitored using analytical ultracentrifugation or size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS).

  • Complementation Studies: In systems where atpF1 knockouts are available, test whether the recombinant protein can restore ATP synthase function when reintroduced into the system, similar to studies performed with other ATP synthase subunits .

What are the critical factors for successful crystallization of atpF1?

Crystallization of membrane proteins like atpF1 presents significant challenges. Based on successful approaches with other ATP synthase subunits, the following factors are critical:

  • Protein Purity and Homogeneity: Achieve >95% purity and monitor sample homogeneity using dynamic light scattering (DLS).

  • Detergent Selection: Screen various detergents including DDM, LDAO, OG, and CYMAL series. Consider detergent exchange during purification to find the optimal environment for crystallization.

  • Crystallization Technique: Both vapor diffusion and lipidic cubic phase (LCP) methods should be attempted, with the latter often more successful for membrane proteins.

  • Stabilizing Additives: Include specific lipids (POPE, POPG), cholesterol hemisuccinate, or small molecular additives like glycerol or specific ions that may stabilize protein conformation.

  • Complex Formation: Consider co-crystallization with binding partners or antibody fragments to provide additional crystal contacts.

A systematic approach using crystallization robots to screen hundreds of conditions is recommended, followed by optimization of promising hits with varying precipitant concentrations, pH, and temperature .

How can I design experiments to study the interaction between atpF1 and other ATP synthase subunits?

To investigate interactions between atpF1 and other ATP synthase subunits, employ a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP): Use antibodies against tagged versions of atpF1 to pull down interacting partners from cell lysates. This can be followed by mass spectrometry analysis to identify binding partners.

  • Yeast Two-Hybrid (Y2H) or Bacterial Two-Hybrid (B2H): These systems can detect direct protein-protein interactions. Design constructs with atpF1 as bait and other ATP synthase subunits as prey to screen for interactions.

  • Förster Resonance Energy Transfer (FRET): Tag atpF1 and potential interacting partners with compatible fluorophores to detect proximity-based energy transfer in vitro or in vivo.

  • Cross-linking Mass Spectrometry (XL-MS): Use chemical cross-linkers to covalently link interacting proteins, followed by proteolytic digestion and mass spectrometry analysis to map interaction interfaces at the amino acid level.

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI): These techniques provide quantitative binding kinetics and can determine binding affinities (Kd values) between purified atpF1 and other subunits.

When designing these experiments, consider creating truncated versions of atpF1 to map specific interaction domains, and introduce site-directed mutations at conserved residues to identify critical interaction sites .

What approaches can be used to study the role of atpF1 in ATP synthase assembly?

Investigating the role of atpF1 in ATP synthase assembly requires sophisticated approaches:

  • Knockdown/Knockout Studies: Use RNA interference or CRISPR-Cas9 to reduce or eliminate atpF1 expression, then analyze the impact on ATP synthase assembly using blue native PAGE and activity assays. Similar approaches with other ATP synthase subunits have revealed critical assembly dependencies, as demonstrated in studies of atp1 in Arabidopsis .

  • Pulse-Chase Experiments: Label newly synthesized proteins with radioisotopes or click chemistry-compatible amino acids to track the temporal sequence of ATP synthase assembly, focusing on when atpF1 is incorporated.

  • Assembly Intermediate Analysis: Use gentle solubilization conditions and sucrose gradient centrifugation to isolate assembly intermediates, then characterize their composition using mass spectrometry to determine the stage at which atpF1 is integrated.

  • Conditional Expression Systems: Design strains with atpF1 under an inducible promoter to study ATP synthase assembly upon controlled expression of atpF1, similar to studies that have examined F1-dependent translation of other ATP synthase components .

  • In vitro Reconstitution: Use purified components to reconstitute ATP synthase assembly steps in vitro, allowing for detailed mechanistic studies of how atpF1 contributes to the process.

ApproachExpected OutcomeControls NeededAnalysis Methods
CRISPR KnockoutAccumulation of assembly intermediatesComplementation with wild-type atpF1BN-PAGE, Western blot, ATP synthesis assays
Conditional ExpressionTime-dependent assembly profileNon-inducing conditionsSucrose gradient, mass spectrometry
In vitro ReconstitutionStep-by-step assembly processOmission of individual componentsEM, activity assays, FRET

These approaches would build upon knowledge gained from similar studies with other ATP synthase subunits, such as the F1-dependent translation observations in yeast .

How can site-directed mutagenesis of atpF1 provide insights into its structure-function relationship?

Site-directed mutagenesis of atpF1 can systematically probe structure-function relationships through the following approach:

  • Target Selection: Identify conserved residues through multiple sequence alignment of atpF1 across species. Focus on:

    • Predicted interface regions with other subunits

    • Highly conserved motifs

    • Charged residues potentially involved in ionic interactions

    • Regions predicted to adopt secondary structure elements

  • Mutation Design Strategy:

    • Conservative substitutions (e.g., Asp to Glu) to test the importance of specific chemical properties

    • Non-conservative substitutions (e.g., Asp to Ala) to completely eliminate side chain functionality

    • Cysteine scanning mutagenesis to introduce sites for chemical modification or cross-linking

  • Functional Analysis: Assess the impact of mutations on:

    • Protein stability and folding using thermal shift assays

    • ATP synthase assembly using blue native PAGE

    • ATP hydrolysis and synthesis rates

    • Proton translocation efficiency

    • Binding affinities to interacting partners

  • Structural Validation: When possible, determine structures of mutant proteins using X-ray crystallography or cryo-EM to directly visualize structural perturbations.

A systematic alanine-scanning approach can be particularly informative, creating a library of single alanine mutants throughout the protein to identify residues critical for function. This approach has been valuable in studies of other ATP synthase subunits, revealing key functional domains and interaction surfaces .

What strategies can be employed to study the translational regulation of atpF1?

Research on other ATP synthase subunits suggests that translational regulation could be an important control point for atpF1 expression. To investigate this aspect:

  • Reporter Systems: Construct fusion proteins with atpF1 5' and 3' UTRs linked to reporter genes (luciferase, GFP) to monitor translational efficiency under various conditions.

  • Ribosome Profiling: Apply this technique to quantitatively measure translation of atpF1 mRNA by deep sequencing of ribosome-protected mRNA fragments. This can reveal translational efficiency and potential regulatory points.

  • RNA-Protein Interaction Studies: Use RNA immunoprecipitation (RIP) or cross-linking immunoprecipitation (CLIP) to identify proteins that bind to atpF1 mRNA and potentially regulate its translation.

  • Translation Dependency Studies: Investigate whether atpF1 translation depends on the presence of other ATP synthase components, similar to the F1-dependent translation observed for Atp6p and Atp8p in yeast mitochondria .

  • Custom-Designed RNA-Binding Proteins: Engineer sequence-specific RNA-binding proteins that target atpF1 mRNA to modulate its expression, building on the approach used for atp1 in Arabidopsis using pentatricopeptide repeat (PPR) proteins .

This multi-faceted approach can reveal mechanisms controlling atpF1 expression levels, which is crucial for understanding the stoichiometric assembly of the ATP synthase complex .

How can I measure the impact of atpF1 alterations on ATP synthase activity?

To quantitatively assess how modifications to atpF1 affect ATP synthase function:

  • ATP Synthesis Assay: Measure ATP production in membrane vesicles or reconstituted proteoliposomes using a luciferin/luciferase-based luminescence assay. This assay can detect the impact of atpF1 mutations on the rate of ATP synthesis under defined proton gradient conditions.

  • ATP Hydrolysis Assay: Quantify ATPase activity using a coupled enzyme assay that links ATP hydrolysis to NADH oxidation, which can be monitored spectrophotometrically. This approach can reveal defects in catalytic function.

  • Proton Translocation Measurements: Use pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor proton pumping activity and determine if atpF1 modifications affect the coupling of ATP hydrolysis to proton movement.

  • Membrane Potential Assays: Employ potentiometric dyes like DiSC3(5) to measure membrane potential generation and dissipation, providing insights into how atpF1 variants affect the integrity of the proton pathway.

  • Single-Molecule Techniques: For detailed mechanistic studies, use single-molecule FRET or optical tweezers to directly observe rotational catalysis and determine how atpF1 modifications influence the mechanical coupling between F₁ and F₀ sectors.

Comparing results from wild-type and mutant proteins can establish structure-function relationships for specific atpF1 domains .

What methods can be used to study atpF1 in the context of intact ATP synthase complexes?

Studying atpF1 within intact ATP synthase complexes requires techniques that preserve native interactions while allowing functional assessment:

  • Cryo-Electron Microscopy (Cryo-EM): This technique can visualize the entire ATP synthase complex at near-atomic resolution, showing how atpF1 interacts with other subunits in the native state. Sample preparation should maintain the integrity of membrane protein complexes using amphipols or nanodiscs.

  • Cross-linking Mass Spectrometry (XL-MS): Use chemical cross-linkers with varying spacer arm lengths to capture interactions between atpF1 and neighboring subunits in the intact complex. Analysis by mass spectrometry can map interaction interfaces at the residue level.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can reveal solvent-accessible regions and conformational changes in atpF1 within the assembled complex under different functional states.

  • Native Mass Spectrometry: Analyze intact ATP synthase complexes using specialized mass spectrometry approaches to determine subunit stoichiometry and stability of complexes containing wild-type versus mutant atpF1.

  • Förster Resonance Energy Transfer (FRET): Introduce fluorescent labels at specific sites in atpF1 and interacting subunits to monitor distances and conformational changes during ATP synthesis/hydrolysis cycles.

These approaches provide complementary information about the structural and functional role of atpF1 within the ATP synthase complex under physiologically relevant conditions .

How does inhibition of ATP synthase assembly through atpF1 manipulation compare to other approaches for studying mitochondrial disorders?

The manipulation of atpF1 to affect ATP synthase assembly represents one of several approaches to study mitochondrial dysfunction. Comparative analysis reveals distinct advantages:

  • Specificity of Effect: Targeting atpF1 specifically affects ATP synthase assembly without directly impacting other respiratory chain complexes. This contrasts with chemical inhibitors like oligomycin or antimycin, which may have broader effects on mitochondrial function. Studies of ATPIF1 manipulation have shown that it specifically regulates ATP synthase activity without directly affecting other ETC complexes .

  • Gradation of Impact: Using techniques such as conditional expression or partial knockdown of atpF1 allows for titration of the effect, enabling studies of threshold effects in ATP synthase function. This gradation capability provides insights into the relationship between ATP synthase levels and cellular phenotypes, similar to what was observed in atp1 knockdown studies in Arabidopsis .

  • Distinction from General ETC Dysfunction: Unlike approaches that target electron transport chain complexes I, III, or IV, atpF1 manipulation specifically affects ATP synthesis without necessarily altering electron flow. This distinction helps separate the consequences of impaired ATP production from those of disrupted electron transport and increased ROS production.

  • Therapeutic Implications: Understanding how cells compensate for reduced ATP synthase assembly through atpF1 manipulation may reveal adaptive responses that could be therapeutically exploited. This approach complements studies showing that inhibition of ATPIF1 can ameliorate the effects of severe mitochondrial respiratory chain disorders .

What insights can comparative studies of atpF1 across different species provide about ATP synthase evolution?

Comparative analysis of atpF1 across species offers valuable evolutionary insights:

  • Structural Conservation and Divergence: By comparing atpF1 sequences from diverse organisms ranging from bacteria to higher eukaryotes, researchers can identify:

    • Core conserved regions essential for fundamental functions

    • Species-specific variations that may reflect adaptations to different environmental niches

    • Co-evolutionary patterns with interacting subunits

  • Functional Adaptations: Species-specific variations in atpF1 may correlate with adaptations to different energy requirements, environmental conditions, or metabolic strategies. For example, thermophilic organisms may have adaptations in atpF1 that enhance stability at high temperatures.

  • Assembly Mechanisms: Comparative studies can reveal different strategies for ATP synthase assembly across species. In yeast, ATP synthase assembly involves F₁-dependent translation of mitochondrially encoded subunits , whereas other organisms may employ different coordination mechanisms.

  • Regulatory Divergence: The regulation of atpF1 expression likely varies across species, reflecting different energetic demands and cellular contexts. Studying these regulatory mechanisms can provide insights into how ATP synthase assembly is coordinated with cellular needs in different organisms.

  • Pathogenic Implications: Understanding conserved features of atpF1 can help identify potential pathogenic mechanisms when these features are disrupted in human mitochondrial disorders.

These comparative studies contribute to our broader understanding of how essential cellular machinery like ATP synthase has evolved while maintaining its core function across diverse life forms .

What are common challenges in working with recombinant atpF1 and how can they be addressed?

Researchers working with recombinant atpF1 often encounter several challenges:

  • Limited Expression Yields:

    • Challenge: As a membrane-associated protein, atpF1 often expresses poorly in standard systems.

    • Solutions:

      • Use specialized expression strains (C41/C43)

      • Lower induction temperature (16-18°C)

      • Co-express with chaperones (GroEL/GroES)

      • Consider fusion partners that enhance solubility (MBP, SUMO)

  • Protein Aggregation:

    • Challenge: atpF1 may aggregate during expression or purification.

    • Solutions:

      • Include stabilizing agents (glycerol, arginine)

      • Optimize detergent type and concentration

      • Avoid freeze-thaw cycles by aliquoting purified protein

      • Consider protein engineering to remove aggregation-prone regions

  • Low Functional Activity:

    • Challenge: Purified atpF1 may show reduced functional activity.

    • Solutions:

      • Verify proper folding using circular dichroism

      • Include specific lipids in purification buffers

      • Test different detergents for their effect on activity

      • Reconstitute with binding partners to stabilize native conformation

  • Protein Degradation:

    • Challenge: atpF1 may be susceptible to proteolytic degradation.

    • Solutions:

      • Add protease inhibitors throughout purification

      • Reduce purification time and temperature

      • Add stabilizing ligands or binding partners

      • Consider engineering protease-resistant variants

A systematic approach to optimization, testing multiple conditions in parallel, can significantly improve outcomes when working with this challenging protein .

How can I develop reliable assays for studying the specific contribution of atpF1 to ATP synthase function?

Developing targeted assays to isolate the contribution of atpF1 requires careful experimental design:

  • Complementation Systems:

    • Engineer systems where endogenous atpF1 is deleted or inactivated

    • Introduce wild-type or mutant versions of atpF1 and measure rescue of function

    • Use inducible promoters to control expression levels and timing

    • This approach allows direct attribution of functional effects to the introduced atpF1 variants

  • Domain Swapping Experiments:

    • Create chimeric proteins by swapping domains between atpF1 from different species

    • Monitor which domains confer specific functional properties

    • This approach can map the functional significance of different regions within atpF1

  • Specific Interaction Assays:

    • Develop pull-down assays using immobilized atpF1 to identify interacting partners

    • Use surface plasmon resonance to quantify binding affinities and kinetics

    • Apply microscale thermophoresis to study interactions in solution

    • These methods can isolate specific interactions involving atpF1

  • Structure-Based Functional Assays:

    • Design assays based on structural knowledge that selectively probe atpF1 function

    • Introduce site-specific labels or probes at key functional sites

    • Monitor conformational changes associated with specific functional states

    • These approaches can provide mechanistic insights into atpF1's role

When developing these assays, it's essential to include appropriate controls, such as known functional mutants and parallel studies with other ATP synthase subunits, to validate assay specificity and sensitivity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.