Recombinant Maricaulis maris Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Maricaulis maris YidC is a partial-length, purified protein expressed in heterologous systems such as E. coli or yeast . It belongs to the YidC/Oxa1/Alb3 family of membrane insertases, which facilitate the integration of nascent membrane proteins into lipid bilayers independently or alongside the Sec translocase . The Maricaulis maris strain (MCS10) from which this protein originates is a marine bacterium isolated from filtered seawater, characterized by its rod-shaped, motile, and mesophilic nature .

Functional Role in Membrane Protein Insertion

Recombinant YidC operates via two primary mechanisms:

  1. Sec-independent insertion: Directly integrates substrate proteins (e.g., Pf3 coat protein) into lipid bilayers through hydrophobic interactions and hydrophilic groove dynamics .

  2. Chaperone activity: Assists in folding membrane proteins post-insertion, preventing aggregation .

Key steps in its insertion mechanism include:

  • Substrate binding to cytoplasmic loops.

  • Salt bridge formation between YidC’s R72/R366 and substrate acidic residues (e.g., D7/D18 of Pf3 coat protein) .

  • Dehydration of the hydrophilic groove to drive substrate translocation .

Mechanistic Insights from Simulations

  • Conformational dynamics: Molecular dynamics (MD) simulations reveal YidC’s TM helices undergo bending and rotation during substrate insertion, with RMSD fluctuations indicating groove flexibility .

  • Role of C2 loop: Deletion of the C2 loop disrupts inter-helical angles (e.g., TM2–TM4), impairing insertion efficiency .

Biochemical Studies

  • Catalytic efficiency: In vitro assays show YidC inserts ~150 substrate molecules per YidC molecule, demonstrating enzymatic turnover .

  • Dependency on hydrophilic groove: Mutations in R366 reduce insertion rates by 70%, underscoring its role in substrate recognition .

Comparative Analysis with Other YidC Orthologs

Table 3: YidC Functional Conservation Across Species

FeatureMaricaulis maris YidCE. coli YidCGram-Positive YidC
TM helices565
Key residueR366R72R72
Sec independenceYesYes (for Pf3 coat)Yes

Challenges and Future Directions

  • Structural resolution: Full-length Maricaulis maris YidC remains uncharacterized due to difficulties in crystallizing membrane proteins .

  • Applications: Potential use in synthetic biology for membrane protein production and antibiotic targeting .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
yidC; Mmar10_0458; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-592
Protein Length
full length protein
Species
Maricaulis maris (strain MCS10)
Target Names
yidC
Target Protein Sequence
MGEDQRNLFIALGLILVILTGYQMFVMGPAEEERRAEQAAVEASQELADPDLPASALEPA AATTVDRETALGGNQRVTIDAPSVLGSLSLTGARLDDVRLRRHTETIDDDTPVALLNPIG SDHVFYARDGWTSATSGFTDLPGGSTEWTLASGSTLTPDTPITLTYDSPSGLHFERVISV DDNYLFTLTDTVTNNSGQEVELSRYGLVRHEGRPEDETRNMAVFEGALAVIDGAMVRSSF GKLEDGNQTEESGTGGWVGITQRYWMAAAVPDQDRPFTARFRTIERGEIDAFEASYVEQA IAVPAGESLASTTRIFAGAKELGVLQQVQNEVGIERFDMAINWGWLWFLTRPFVWLLTML EGALGQFGLAILALTLMVKIVMFPLANRAYASMAKMKAVQPKMAEIKERYGADQQKQQQA LMELYKTEKINPLAGCLPILPQIPIFFALYQTLFNAIEMRHAPFFGWIRDLSAADPTNIW NLFGLIPYDPTGIWLIGGVLGIGAWPIIMGLTMAAQQALNPPPPDPMQARIFAFLPIVFT FILAPFAAGLVIYWAWNNFLSVLQQYIIMRRHGNETQVDKLVARLLKRDRGD
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It is involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC also aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of YidC in Maricaulis maris?

The Maricaulis maris YidC is a membrane protein insertase consisting of 592 amino acids with multiple transmembrane regions that form a unique hydrophilic cavity structure within the membrane. The protein sequence includes several hydrophobic transmembrane segments that anchor the protein in the membrane while creating a specialized microenvironment for substrate interaction . This structure enables YidC to function as a proteinaceous amphiphile that interacts with newly synthesized membrane proteins and reduces the energetic costs of their membrane traversal .

Unlike conventional translocons that create a polypeptide-conducting transmembrane channel, YidC mediates membrane protein insertion by means of an intramembrane cavity that is open to the aqueous environment . This cavity contains a conserved positive charge that electrostatically interacts with charges on the substrate hydrophilic regions, recruiting them into the groove and reducing their membrane-crossing distance . The hydrophilic microenvironment is functionally important, as it facilitates the passage of membrane proteins without requiring the formation of a continuous transmembrane pore.

How does YidC facilitate membrane protein insertion?

YidC facilitates membrane protein insertion through multiple coordinated mechanisms that have been elucidated through structural and functional studies. The protein operates via a "greasy-sliding" mechanism, where hydrophobic residues in transmembrane helices (particularly TM3 and TM5) interact with substrate transmembrane segments to guide their insertion into the lipid bilayer . Cross-linking studies have confirmed that these hydrophobic residues bind substrate TM segments, such as those from Pf3 coat protein and MscL .

The insertion process begins with the recruitment of substrate proteins to YidC's hydrophilic groove, where conserved charged residues create an electrostatically favorable environment . Molecular dynamics simulations have shown that YidC induces membrane thinning around its structure, further reducing the energetic barrier for substrate translocation . Time-resolved single-molecule FRET analysis has demonstrated that the entire process of substrate contact, insertion, and separation from YidC occurs rapidly, within approximately 20 milliseconds, with insertion rates reaching 500 molecules per second in reconstituted systems .

YidC also assists in the proper folding of membrane proteins after insertion, suppressing misfolding of structural segments and enhancing the probability of proper membrane integration . This chaperone-like function is particularly important for complex membrane proteins with multiple transmembrane domains that might otherwise misfold during the insertion process.

What are the key conserved domains in Maricaulis maris YidC?

The Maricaulis maris YidC contains several key conserved domains that are essential for its function as a membrane protein insertase. The protein features a conserved 5-transmembrane core that forms the characteristic hydrophilic cavity facing the cytoplasm . This cavity includes specific residues that are critically conserved across bacterial species, including charged amino acids that facilitate electrostatic interactions with substrate proteins .

The hydrophobic residues in TM3 and TM5 form a "greasy slide" that constitutes a major substrate contact site, being conserved across YidC homologs to enable the binding of substrate transmembrane segments . The cytosolic loops C1, C2, and the C-terminal tail region also represent functionally important domains that may be involved in substrate recognition or interaction with other cellular components .

What methodologies are effective for studying YidC-mediated membrane insertion?

Studying YidC-mediated membrane insertion requires a multifaceted approach combining structural, biochemical, and biophysical methodologies. X-ray crystallography has been instrumental in determining the three-dimensional structure of YidC, providing critical insights into the hydrophilic cavity and the arrangement of transmembrane helices . This approach requires careful optimization of crystallization conditions, often using detergent-solubilized protein preparations or lipidic cubic phase methods to maintain protein stability.

Cryo-electron microscopy (Cryo-EM) represents another powerful structural approach, particularly useful for examining YidC in complex with substrate proteins . This technique has revealed the proximity of substrate transmembrane segments to YidC's greasy slide, providing direct visualization of insertion intermediates .

Cross-linking studies combined with mass spectrometry have effectively mapped substrate contact sites within YidC, identifying specific residues involved in substrate binding . This approach typically involves introducing photo-activatable or chemical cross-linkers at strategic positions, followed by cross-linking induction and identification of cross-linked peptides.

For kinetic analysis of insertion, time-resolved single-molecule FRET (Förster Resonance Energy Transfer) has proven particularly valuable, enabling real-time monitoring of substrate contact, insertion, and release . This approach requires strategic placement of fluorescent labels on both YidC and substrate proteins to monitor distance changes during the insertion process.

Molecular dynamics simulations provide complementary insights into conformational changes and energetics of YidC-mediated insertion . Both equilibrium and non-equilibrium approaches (such as targeted MD implemented in the colvars module of NAMD) have been effectively employed to investigate different stages of the insertion mechanism .

How does the hydrophilic cavity of YidC contribute to its function?

The hydrophilic cavity of YidC plays a central role in its function as a membrane protein insertase, creating a unique microenvironment that facilitates the energetically unfavorable process of translocating hydrophilic segments across the membrane. Research has demonstrated that this cavity is genuinely accessible to the aqueous environment in living cells, confirming its biological relevance .

The cavity contains conserved charged residues, particularly a positive charge that interacts electrostatically with negative charges on substrate proteins . This electrostatic interaction serves to recruit substrate proteins into the insertion groove and reduce the effective distance that hydrophilic segments must traverse during membrane crossing .

Molecular dynamics simulations have further revealed that YidC induces thinning of the membrane region surrounding the protein, which contributes to reducing the membrane crossing distance for substrates . The combination of the hydrophilic cavity, membrane thinning, and specific electrostatic interactions collectively enables YidC to function as a specialized insertion facilitator that lowers the energy barrier for membrane protein integration.

What experimental approaches can identify the substrate specificity of Maricaulis maris YidC?

Determining the substrate specificity of Maricaulis maris YidC requires systematic approaches combining in vivo and in vitro methodologies. Complementation assays in YidC-depleted or YidC-conditional mutant bacterial strains represent a powerful approach to assess the functional capacity of Maricaulis maris YidC to insert various substrate proteins. By monitoring the growth and membrane protein content of these cells, researchers can identify which substrates depend on YidC for proper insertion.

In vitro reconstitution systems using purified YidC incorporated into liposomes provide a controlled environment to directly assess insertion activity . Such proteoliposome systems can be used to test the insertion of model substrates like Pf3 coat protein, which has been extensively studied with other YidC homologs . By measuring insertion efficiency across diverse substrates, researchers can develop a specificity profile for the Maricaulis maris protein.

Cross-linking studies with photo-activatable or chemical cross-linkers strategically placed in potential substrate proteins can map interaction sites and binding affinities . This approach can identify specific sequence or structural elements that determine YidC recognition, potentially revealing unique substrate preferences of the Maricaulis maris homolog.

Biochemical pull-down assays combined with mass spectrometry represent a powerful approach for unbiased identification of YidC interaction partners. By immobilizing purified Maricaulis maris YidC and incubating it with cellular extracts or purified candidate substrates, researchers can isolate and identify interacting proteins, potentially revealing novel substrates specific to this YidC homolog.

What are the optimal conditions for expressing and purifying recombinant Maricaulis maris YidC?

Expression and purification of membrane proteins like YidC present significant challenges that require careful optimization. For recombinant expression, E. coli-based systems using specialized strains (such as C41/C43(DE3) or Lemo21(DE3)) designed for membrane protein expression often provide good yields . These strains mitigate the toxicity often associated with membrane protein overexpression. The full-length sequence of Maricaulis maris YidC (amino acids 1-592) should be incorporated into an expression vector with an appropriate tag (typically His6, FLAG, or Strep-tag) to facilitate purification .

Expression conditions require careful optimization, with induction typically performed at lower temperatures (16-20°C) to slow protein production and facilitate proper membrane integration. The addition of specific inducer concentrations (such as IPTG at 0.1-0.5 mM) should be empirically determined to balance protein yield and quality. Membrane fractionation following cell lysis represents a critical step, requiring differential centrifugation to separate membrane fractions containing the recombinant YidC.

Solubilization of the membrane protein requires screening multiple detergents to identify those that maintain protein stability and activity. Common detergents for YidC purification include n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin. The purification protocol typically involves immobilized metal affinity chromatography (IMAC) for initial capture, followed by size exclusion chromatography (SEC) to achieve homogeneity and remove detergent micelles .

For functional studies, reconstitution into liposomes may be necessary, requiring optimization of lipid composition and protein-to-lipid ratios to maintain activity. A mixture of E. coli polar lipids with phosphatidylcholine often provides a suitable membrane environment for YidC function.

How can researchers effectively measure YidC-substrate interactions in real-time?

Real-time measurement of YidC-substrate interactions requires sophisticated biophysical techniques that can capture the dynamic nature of membrane protein insertion. Single-molecule Förster Resonance Energy Transfer (smFRET) has emerged as a particularly powerful approach, enabling researchers to monitor distance changes between strategically placed fluorophores on YidC and substrate proteins during the insertion process . This technique has revealed that substrate contact, insertion, and separation from YidC can occur within milliseconds, with insertion rates reaching hundreds of molecules per second .

Surface plasmon resonance (SPR) provides another valuable approach for measuring binding kinetics between YidC and substrate proteins. This technique requires immobilization of either YidC or the substrate on a sensor chip, allowing real-time monitoring of association and dissociation rates. For membrane proteins like YidC, specialized sensor chips coated with lipid bilayers or nanodiscs can maintain the protein in a near-native environment.

Microscale thermophoresis (MST) offers advantages for measuring interactions in solution, requiring minimal sample amounts and avoiding immobilization. This technique detects changes in the thermophoretic mobility of fluorescently labeled molecules upon binding, enabling determination of binding affinities under near-physiological conditions.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) represents a powerful approach for mapping conformational changes during YidC-substrate interactions, identifying regions with altered solvent accessibility upon binding. This information can reveal structural rearrangements that occur during the insertion process and identify key interaction interfaces.

For high-throughput screening of potential YidC substrates, biolayer interferometry (BLI) enables rapid assessment of multiple binding interactions in parallel, potentially accelerating the identification of substrate specificity determinants.

What structural biology techniques are most appropriate for studying Maricaulis maris YidC?

Multiple structural biology techniques offer complementary insights into the structure and function of Maricaulis maris YidC, each with distinct advantages. X-ray crystallography has been successfully applied to YidC homologs, revealing the architecture of the hydrophilic cavity and the arrangement of transmembrane helices . For crystallization, it's critical to optimize detergent selection, often requiring a detergent screen to identify conditions that maintain protein stability while promoting crystal formation. Lipidic cubic phase (LCP) crystallization has proven particularly effective for membrane proteins like YidC.

Cryo-electron microscopy (cryo-EM) offers significant advantages for studying membrane proteins, particularly for capturing YidC-substrate complexes that may be conformationally heterogeneous . Recent advances in detector technology and image processing have enabled near-atomic resolution structures of membrane proteins without requiring crystallization, making this approach increasingly valuable for YidC structural studies.

Solution nuclear magnetic resonance (NMR) spectroscopy, while challenging for full-length membrane proteins, can provide valuable dynamics information for specific domains or segments of YidC. This approach is particularly valuable for studying the cytosolic loops and C-terminal tail region, which may undergo conformational changes during the insertion process .

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers insights into protein dynamics and solvent accessibility, potentially revealing conformational changes that occur during substrate binding and insertion. This technique is particularly valuable for mapping the hydrophilic cavity region that plays a central role in YidC function .

Computational structural biology approaches, including homology modeling and molecular dynamics simulations, complement experimental techniques by providing atomic-level insights into conformational changes and energetics . These approaches have been successfully applied to YidC homologs to investigate membrane thinning effects and substrate insertion pathways .

How can molecular dynamics simulations enhance understanding of YidC function?

Molecular dynamics (MD) simulations represent a powerful computational approach for investigating the mechanistic details of YidC-mediated membrane protein insertion at atomic resolution. Both equilibrium and non-equilibrium MD simulations have proven effective for investigating biological challenges related to membrane protein insertion . These simulations can reveal conformational changes, energetics, and dynamics that are difficult to capture with experimental approaches alone.

For YidC studies, MD simulations can be particularly valuable for investigating membrane thinning effects around the insertase. Previous simulations have revealed that YidC induces local thinning of the membrane bilayer, reducing the effective distance that substrate proteins must traverse during insertion . This phenomenon can be quantified by measuring membrane thickness as a function of distance from YidC throughout the simulation trajectory.

Non-equilibrium targeted MD (TMD) simulations, as implemented in software packages like NAMD's colvars module, enable researchers to model the complete insertion process by applying biasing forces that guide substrate proteins from the cytoplasmic side to their final transmembrane configuration . These simulations can identify energy barriers, key interaction points, and conformational changes during insertion.

Coarse-grained MD simulations offer the advantage of extended timescales (microseconds to milliseconds) that better match the biological timescales of insertion events, albeit at reduced atomic detail. This approach is particularly valuable for investigating large-scale conformational changes and lipid reorganization during YidC-mediated insertion.

Analysis of MD simulation data requires sophisticated approaches, including principal component analysis to identify major modes of protein motion, hydrogen bond analysis to characterize interactions within the hydrophilic cavity, and free energy calculations to quantify energetic barriers during insertion . These analyses can provide mechanistic insights that complement and extend experimental findings.

What comparative approaches can reveal functional differences between YidC homologs?

Structural comparison of crystallographically determined YidC structures from different species has revealed both conserved features (such as the hydrophilic cavity) and species-specific differences . For Maricaulis maris YidC, comparative structural analysis with homologs from both Gram-positive and Gram-negative bacteria can highlight unique features that may influence substrate specificity or insertion mechanism.

Functional complementation experiments in heterologous systems provide direct evidence of functional conservation or divergence. By expressing Maricaulis maris YidC in YidC-depleted strains of model organisms like E. coli, researchers can assess whether the protein can functionally replace the native insertase and identify any substrate-specific differences in complementation efficiency.

Chimeric protein approaches, in which domains from different YidC homologs are exchanged, can pinpoint regions responsible for functional differences between species. This approach has been particularly valuable for identifying determinants of substrate specificity and membrane targeting across YidC homologs.

Comparative biochemical analysis of purified YidC homologs, including measurements of insertion kinetics, substrate binding affinities, and lipid preferences, can reveal quantitative differences in function that may reflect adaptation to different cellular environments or substrate repertoires .

What are the emerging research frontiers in YidC biology?

The study of YidC insertases continues to evolve, with several emerging frontiers that promise to deepen our understanding of membrane protein biogenesis. Structural determination of substrate-bound YidC complexes represents a major goal that would provide direct visualization of the insertion process, potentially revealing conformational changes and interaction interfaces not apparent in substrate-free structures . Advanced cryo-EM approaches, potentially combined with novel membrane mimetics, offer promising routes toward this goal.

Investigation of the proton motive force (PMF) dependency of YidC-mediated insertion represents another frontier, as the PMF has been implicated in the release of hydrophilic domains from the YidC groove, though the precise mechanism remains unclear . Biophysical approaches that enable controlled manipulation of transmembrane potentials during insertion assays could provide critical insights into this aspect of YidC function.

The potential role of YidC in co-translational insertion pathways, possibly in coordination with the ribosome and/or SecYEG translocon, represents an important area for further investigation . Structural and functional studies of YidC-ribosome complexes could reveal how YidC facilitates the integration of nascent membrane proteins as they emerge from the ribosome.

Development of tailored inhibitors or modulators of YidC function would enable more precise manipulation of membrane protein biogenesis pathways in live cells, potentially revealing new aspects of YidC biology and possibly opening avenues for antimicrobial development targeting this essential bacterial process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.