Recombinant Marinobacter aquaeolei Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism

DsbB operates as a redox relay partner for DsbA, enabling de novo disulfide bond formation:

  1. Oxidation Cycle:

    • DsbB accepts electrons from reduced DsbA via thiol-disulfide exchange, regenerating DsbA’s active-site disulfide .

    • Electrons are transferred to membrane-embedded quinones (e.g., ubiquinone), linking disulfide bond formation to respiratory chain energetics .

  2. Redox Potentials:

    • The Cys41-Cys44 disulfide in DsbB has a redox potential of –69 mV, making it the most oxidizing known protein disulfide .

    • This enables DsbB to oxidize DsbA (–122 mV) despite DsbA’s inherent oxidizing capacity .

  3. Kinetics:

    • DsbB-DsbA binding occurs rapidly (k₁ ≈ 5 × 10⁵ M⁻¹s⁻¹), followed by quinone-mediated reoxidation .

Biotechnological Applications

Recombinant M. aquaeolei DsbB is utilized in:

  • Protein Engineering: Facilitating correct disulfide bond formation in heterologously expressed proteins .

  • Enzymatic Studies: Serving as a model for mechanistic analyses of bacterial oxidative folding pathways .

  • Industrial Microbiology: Enhancing yields of disulfide-rich proteins in Marinobacter and related species .

Research Gaps and Future Directions

While E. coli DsbB mechanisms are well-characterized , M. aquaeolei DsbB lacks direct structural or kinetic studies. Key unanswered questions include:

  • How does its quinone-binding site differ from E. coli DsbB?

  • Does it interact with novel redox partners in mixotrophic environments ?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is contingent upon various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To avoid degradation, minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please communicate them to us, and we will prioritize development of the specified tag.
Synonyms
dsbB; Maqu_0468; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)
Target Names
dsbB
Target Protein Sequence
MTSRWIFGLVFLVCAGLLAVAFYMEHVMGLEPCPLCWLQRFGFMGAGLVSLLAFLHGPRG FGNRVYGLLLIVAAGAGLAVAGRQLWLQSLPADQVPACGPSVDYMLEVLPWFEVLQTALK GTGDCAEVVWRFLGLSIPGWTAVFFSLLIVLGLFVMLRRYSPRDWLQS
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. Its function involves oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Disulfide bond formation protein B (DsbB) and what is its function in Marinobacter aquaeolei?

Disulfide bond formation protein B (DsbB) is a cytoplasmic membrane protein that plays a crucial role in the oxidative folding pathway of proteins. In bacteria, DsbB functions primarily to reoxidize the disulfide bond formation protein A (DsbA) after DsbA catalyzes disulfide bond formation in substrate proteins. In Marinobacter aquaeolei, which is a biofilm-forming, facultative mixotroph capable of performing redox reactions using oxygen and nitrate as terminal electron acceptors, DsbB likely maintains the redox balance required for proper protein folding in the periplasmic space .

The pathway for disulfide bond formation typically involves DsbB transferring electrons from DsbA to ubiquinone in the respiratory chain, enabling DsbA to continually catalyze disulfide bond formation in newly synthesized proteins. Based on studies in model organisms like E. coli, mutations in dsbB result in severe defects in disulfide bond formation in various proteins, including outer membrane proteins and secreted enzymes .

What expression systems are commonly used for producing recombinant Marinobacter aquaeolei DsbB?

Based on analogous proteins, several expression systems can be employed for producing recombinant Marinobacter aquaeolei DsbB:

Expression SystemAdvantagesChallengesTagged Constructs
E. coli T7 promoter systems (pET vectors)High expression levels, well-established protocolsMembrane protein expression can be toxic, potential inclusion body formationN-His, C-His, GST fusion
HEK 293 cellsMammalian expression allows proper folding of complex proteinsHigher cost, longer expression timeSignal peptide-directed secretion, Fc fusion
Insect cell/baculovirusGood for membrane proteins, post-translational modificationsComplex system setup, higher costPolyhistidine tags, FLAG tags

For E. coli-based expression systems, optimization of the dsbB coding region using PCR amplification and cloning into T7 promoter expression vectors like pET-3a has been demonstrated for E. coli DsbB, which could be adapted for M. aquaeolei DsbB . The overexpression approach would need to account for the membrane-bound nature of DsbB.

What are the optimal conditions for expressing and purifying active recombinant Marinobacter aquaeolei DsbB?

Optimal expression and purification of recombinant M. aquaeolei DsbB requires careful consideration of its membrane-bound nature. Based on studies with similar proteins, the following protocol elements are critical:

  • Expression conditions:

    • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

    • Induction: Low IPTG concentrations (0.1-0.5 mM) with extended expression times

    • Media supplements: Addition of glucose (0.5-1%) to repress basal expression

    • Specialized strains: C41(DE3) or C43(DE3) designed for membrane protein expression

  • Purification strategy:

    • Membrane isolation: Differential centrifugation followed by membrane solubilization

    • Detergent selection: Critical for maintaining protein activity (e.g., DDM, LDAO)

    • Chromatography sequence: IMAC followed by size exclusion chromatography

    • Buffer optimization: Including stabilizing agents such as glycerol (10-15%)

  • Activity preservation:

    • Maintenance of oxidizing conditions during purification

    • Addition of ubiquinone analogues to stabilize the protein

    • Prevention of disulfide scrambling by avoiding reducing agents

When assessing protein quality, it's essential to verify both the structural integrity and functional activity of the purified DsbB, which can be accomplished through thermal shift assays, circular dichroism, and functional assays measuring electron transfer to quinones.

How can researchers effectively analyze the interaction between DsbB and DsbA in Marinobacter aquaeolei?

Studying the interaction between DsbB and DsbA in M. aquaeolei requires multiple complementary approaches:

  • In vitro interaction assays:

    • Surface Plasmon Resonance (SPR) to determine binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) for interaction in solution

  • Structural studies:

    • X-ray crystallography of the DsbA-DsbB complex

    • Cryo-EM analysis to visualize the membrane-embedded complex

    • NMR studies of specific interaction domains

  • Functional assays:

    • Enzyme kinetics measuring DsbA reoxidation rates

    • Disulfide exchange assays using fluorescence-based reporters

    • In vivo complementation studies in dsbA/dsbB deficient strains

  • Computational approaches:

    • Molecular dynamics simulations of the complex

    • Protein-protein docking predictions

    • Sequence-based coevolution analysis

Based on E. coli studies, researchers have demonstrated that DsbB is required for the oxidation of DsbA in the disulfide bond formation pathway . By adapting these methodologies to M. aquaeolei proteins, researchers can elucidate the specific mechanisms of this crucial redox partnership in this marine bacterium.

What methodologies are recommended for investigating the role of DsbB in Marinobacter aquaeolei biofilm formation?

Investigating the role of DsbB in M. aquaeolei biofilm formation requires a multifaceted approach:

  • Genetic manipulation strategies:

    • Construction of dsbB knockout mutants using homologous recombination

    • Complementation studies with wild-type and mutant dsbB alleles

    • Inducible expression systems to control DsbB levels

  • Biofilm assessment techniques:

    • Crystal violet staining for quantitative biofilm measurement

    • Confocal laser scanning microscopy for 3D biofilm architecture analysis

    • Flow cell systems for continuous biofilm development monitoring

  • Biochemical assays:

    • Analysis of extracellular matrix composition in wild-type vs. dsbB mutants

    • Enzymatic activity assays for secreted proteins dependent on disulfide bonds

    • Redox state analysis of key proteins in the biofilm matrix

  • Transcriptomic and proteomic analyses:

    • RNA-Seq to identify genes differentially expressed in dsbB mutants

    • Proteomics to identify changes in disulfide-bonded protein abundance

    • Redox proteomics to assess the oxidation state of cysteine-containing proteins

Since M. aquaeolei is known to be a biofilm-forming organism , and proper disulfide bond formation is often critical for the function of extracellular and membrane proteins involved in biofilm formation, the DsbB protein likely plays a significant role in this process by ensuring correct folding of these proteins.

How should researchers address contradictory findings about DsbB function across different bacterial species when studying M. aquaeolei DsbB?

Addressing contradictory findings requires systematic analysis and context consideration:

  • Contextual analysis framework:

    • Identify specific experimental conditions leading to contradictions

    • Determine if contradictions relate to function, structure, or regulation

    • Assess whether species-specific differences explain contradictory results

  • Methodological approach to resolving contradictions:

    • Direct side-by-side comparison using identical experimental conditions

    • Development of species-specific assays accounting for physiological differences

    • Utilization of heterologous expression systems to isolate protein-specific effects

  • Computational resolution strategies:

    • Knowledge graph approaches to identify contextual differences in contradictory studies

    • Machine learning methods to predict species-specific functional variations

    • Molecular dynamics simulations to identify structural determinants of functional differences

  • Reporting recommendations:

    • Clear documentation of all experimental parameters

    • Explicit discussion of how findings relate to contradictory literature

    • Proposed models that reconcile contradictory findings when possible

Recent research has shown that apparent contradictions in scientific literature often stem from differences in experimental context, including "population group being studied, species or dosage group" . When studying M. aquaeolei DsbB, researchers should carefully consider how the marine environment and specific physiological adaptations of this organism might influence DsbB function compared to model organisms like E. coli.

What experimental approaches can be used to investigate the redox partners of DsbB in Marinobacter aquaeolei?

Identifying and characterizing the redox partners of DsbB in M. aquaeolei requires multiple experimental approaches:

  • Identification of redox partners:

    • Pull-down assays using tagged DsbB to capture interacting proteins

    • BioID or APEX2 proximity labeling to identify proteins in close proximity

    • Yeast two-hybrid screening with membrane-based systems

    • Co-immunoprecipitation coupled with mass spectrometry

  • Verification of direct electron transfer:

    • In vitro reconstitution of electron transfer chains

    • Stopped-flow kinetics to measure electron transfer rates

    • Site-directed mutagenesis of putative interaction sites

    • EPR spectroscopy to track radical species during electron transfer

  • Physiological relevance assessment:

    • Growth and phenotype analysis of partner gene knockouts

    • Metabolic flux analysis under different redox conditions

    • Complementation studies with heterologous redox partners

    • In vivo redox state monitoring using redox-sensitive fluorescent proteins

Potential Redox PartnerDetection MethodConfirmation ApproachPhysiological Role
Quinones (ubiquinone/menaquinone)UV-vis spectroscopy, HPLCQuinone binding assaysElectron transfer to respiratory chain
Cytochrome partnersDifference spectroscopyDirect electron transfer kineticsAlternative electron acceptors
Thioredoxin-like proteinsPull-down assaysThiol-disulfide exchange assaysElectron transfer network connections

In E. coli, DsbB transfers electrons from DsbA to ubiquinone in the respiratory chain . Given M. aquaeolei's ability to perform redox reactions using oxygen and nitrate as terminal electron acceptors , its DsbB likely interfaces with similar respiratory components, but may have adapted to the specific redox environment of this marine bacterium.

What antibody-based approaches are available for detecting and isolating recombinant M. aquaeolei DsbB?

While specific antibodies against M. aquaeolei DsbB are not directly mentioned in the search results, researchers can develop and utilize antibody-based approaches based on related systems:

  • Types of available antibodies:

    • Recombinant antibodies like those developed against E. coli DsbB

    • Antibodies against conserved epitopes across bacterial DsbB proteins

    • Tag-specific antibodies when working with tagged recombinant constructs

  • Applications in research:

    • Western blotting to detect expression and processing

    • Immunofluorescence to determine cellular localization

    • Flow cytometry for quantitative analysis in cell populations

    • Immunoprecipitation for protein complex isolation

  • Development of custom antibodies:

    • Selection of immunogenic epitopes specific to M. aquaeolei DsbB

    • Recombinant antibody expression using HEK 293 cells

    • Validation for specificity using knockout controls

  • Benefits of recombinant antibody technology:

    • Increased sensitivity and confirmed specificity

    • High repeatability and excellent batch-to-batch consistency

    • Sustainable supply and animal-free production

When developing antibodies against M. aquaeolei DsbB, researchers could follow approaches similar to those used for recombinant anti-E. coli DsbB antibodies, which are expressed as combinations of heavy chains containing VH from anti-DsbB mAb and CH1-3 region of human IgG1, and light chains encoding VL from anti-DsbB mAb and CL of human kappa light chain .

How can computational approaches be used to predict structure-function relationships in M. aquaeolei DsbB?

Computational approaches offer powerful tools for predicting and analyzing structure-function relationships:

  • Structural prediction methods:

    • Homology modeling based on solved DsbB structures from related organisms

    • Ab initio modeling for unique domains with no structural homologs

    • Molecular dynamics simulations to study conformational dynamics

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for redox active sites

  • Functional annotation approaches:

    • Sequence-based function prediction using conserved motifs

    • Structure-based function prediction through binding site analysis

    • Network-based approaches examining protein-protein interaction data

    • Evolutionary analysis to identify functionally important residues

  • Integration with experimental data:

    • Refinement of models with low-resolution experimental data

    • Validation of predictions through targeted mutagenesis

    • Design of experiments based on computational hypotheses

  • Knowledge graph applications:

    • Integration of literature-derived knowledge about DsbB function

    • Identification and resolution of contradictory findings about DsbB

    • Context-aware inference to predict M. aquaeolei-specific properties

Recent advances in computational drug discovery using knowledge graphs highlight the potential of using artificial intelligence-based methods to extract context and resolve contradictions in scientific knowledge about proteins like DsbB . These approaches can be particularly valuable when working with less-studied organisms like M. aquaeolei, allowing researchers to leverage knowledge from better-characterized systems while accounting for species-specific differences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.