Recombinant Marinobacter aquaeolei Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Marinobacter aquaeolei Na⁺-translocating NADH-quinone reductase subunit E (NqrE) is a critical component of the bacterial Na⁺-NQR enzyme complex, which couples electron transfer from NADH to quinone with sodium ion translocation across membranes . This subunit is encoded by the nqrE gene (UniProt ID: A1U1Y9) and expressed recombinantly in E. coli for research applications .

Biological Role in Na⁺-NQR Complex

The Na⁺-NQR complex is a primary sodium pump in marine and pathogenic bacteria, generating a sodium motive force (smf) to drive ATP synthesis, substrate transport, and motility . Subunit E collaborates with subunits A, B, C, D, and F to form the functional enzyme. Key features include:

  • Electron Transfer Pathway: Electrons flow from NADH via flavins (bound to subunits B and C) and a 2Fe-2S cluster (subunit F) to quinone, coupled with Na⁺ extrusion .

  • Sodium Sensitivity: Activity increases up to 5-fold in the presence of Na⁺, with a turnover rate of 720 electrons/second in Vibrio cholerae homologs .

  • Structural Insights: Subunit E contributes to membrane anchoring and stabilization of the redox cofactors .

3.1. Mechanistic Studies

Recombinant NqrE enables structural and functional dissection of Na⁺-NQR:

  • Redox Centers: UV-visible spectroscopy identifies three flavins (FAD) and one 2Fe-2S cluster per complex .

  • Electrogenic Activity: Reconstitution into liposomes demonstrates Na⁺ gradient generation (Δψ ~180 mV) .

3.2. Biotechnological Relevance

  • Bioenergetics Model: Serves as a template for studying Na⁺-coupled respiration in extremophiles like M. aquaeolei, which thrives in hydrocarbon-rich marine environments .

  • Comparative Genomics: Homologs in Pseudoalteromonas atlantica (UniProt: Q15YQ2) share 67% sequence identity, highlighting evolutionary conservation .

Comparative Analysis of Homologs

FeatureM. aquaeolei NqrE P. atlantica NqrE V. cholerae NqrE
Amino Acid SequenceMEHYLSLLLKAIFVENMALAFFLGM...MEQYLSLFIRSIFLENMALFYFLGM...Not fully resolved
Expression SystemE. coliE. coliV. cholerae (native)
Functional RedundancyCritical for Na⁺ pumpingConserved in marine generaLinked to pathogenicity

Implications for Microbial Physiology

In M. aquaeolei, Na⁺-NQR supports mixotrophic growth under oxidative stress, enabling survival in oil-contaminated environments . Its role in denitrification (via redox coupling with nitrate reductases) further underscores its ecological significance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preference for a particular tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
nqrE; Maqu_1927; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)
Target Names
nqrE
Target Protein Sequence
MEHYLSLLLKAIFVENMALAFFLGMCTFLAISKKIEAATGLGIAVVVVLTVTVPVNNLLY NTILREGALDWAGLPNVDLSFLGLLTYIGVIAAIVQIMEMVLDKYIPALYAALGVFLPLI TVNCAILGASLFMVERDYTFGESLVYGFGAGVGWALAIIALAGIREKLKYSDVPNGLRGL GITFITVGLMSLGFMSFSGISL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions. These reactions are coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, which converts ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Marinobacter aquaeolei Na(+)-translocating NADH-quinone reductase?

Na(+)-translocating NADH-quinone reductase (NQR) is a respiratory chain enzyme complex found in marine bacteria. While specific structural data for M. aquaeolei NQR is still developing, similar NQR complexes in marine bacteria like Vibrio alginolyticus consist of three primary subunits (alpha, beta, and gamma) with molecular weights of approximately 52, 46, and 32 kDa, respectively . The beta subunit contains FAD and is responsible for the initial reaction with NADH, which reduces ubiquinone-1 (Q-1) via single-electron transfer to produce ubisemiquinones. The alpha subunit contains FMN and works together with the gamma subunit to convert Q-1 to ubiquinol-1 without free radical accumulation . Subunit E would likely be one of the components involved in the electron transfer pathway of this complex respiratory enzyme.

How does the Na(+)-dependent activity of this enzyme contribute to M. aquaeolei's halotolerance?

The Na(+)-dependent activity of this enzyme is central to M. aquaeolei's halotolerance capabilities. The reaction catalyzed by the alpha subunit of Na(+)-translocating NADH-quinone reductase is strictly dependent on Na+ and is tightly coupled to the electrogenic extrusion of Na+ across the cell membrane . This mechanism allows M. aquaeolei to maintain ionic homeostasis in saline environments. Genomic analysis reveals that Marinobacter species possess adaptations for halotolerance, enabling them to thrive in diverse marine environments with varying salinity levels . The Na(+)-translocating NQR effectively converts the energy from NADH oxidation into an electrochemical sodium gradient that can be used for various cellular processes, including nutrient uptake and maintaining ion balance in high-salt conditions.

What expression systems are most effective for producing recombinant M. aquaeolei NQR subunit E?

For recombinant expression of membrane proteins like NQR subunit E, E. coli expression systems with modifications for membrane protein production are generally effective. Based on research with similar proteins, the following methodological approach is recommended:

Expression SystemVector TypeInduction MethodBenefits
E. coli BL21(DE3)pET series vectorsIPTG (0.1-0.5 mM)High yield, tight regulation
E. coli C41/C43pBAD vectorsArabinose (0.002-0.2%)Specialized for membrane proteins
Cell-free systemsLinear templatesDirect protein synthesisAvoids toxicity issues

Expression should be performed at lower temperatures (16-25°C) after induction to facilitate proper folding. Adding specific chaperones and optimizing growth media with appropriate salinity (mimicking marine conditions) can improve functional yield. For purification, a combination of detergent solubilization (typically using n-dodecyl β-D-maltoside) followed by affinity chromatography using engineered His-tags has proven effective for similar membrane-bound respiratory enzymes.

How can the enzymatic activity of recombinant NQR subunit E be accurately measured?

Measuring the enzymatic activity of recombinant NQR subunit E requires techniques that can monitor electron transfer and Na+ translocation. The following methodological approaches are recommended:

  • Spectrophotometric assays: Monitor NADH oxidation by measuring absorbance decrease at 340 nm in the presence of appropriate electron acceptors like ubiquinone-1.

  • Oxygen consumption measurements: Using an oxygen electrode to measure respiration rates in reconstituted systems.

  • Sodium ion flux measurements: Employing sodium-sensitive fluorescent dyes or radioactive 22Na+ to track sodium translocation.

  • Inhibitor studies: Using specific inhibitors like 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO), which strongly inhibits the Na+-dependent reaction catalyzed by the alpha subunit .

All assays should be performed in buffers containing varying Na+ concentrations to establish Na+-dependency curves. Activity comparisons between wild-type and mutant forms can provide insights into structure-function relationships.

What is the electron transfer mechanism within the M. aquaeolei NQR complex and how does subunit E contribute?

The electron transfer mechanism within the M. aquaeolei NQR complex involves a sophisticated relay of electrons across multiple cofactors. Based on related NQR systems, the process likely follows this pathway:

  • NADH binds to the FAD-containing domain and transfers electrons

  • Electrons move through various redox-active centers (potentially including FMN, iron-sulfur clusters, and other cofactors)

  • Ubiquinone is ultimately reduced to ubiquinol

How does the M. aquaeolei NQR complex compare with similar enzymes from other marine bacteria like Vibrio alginolyticus?

Comparative analysis between M. aquaeolei and V. alginolyticus NQR complexes reveals both similarities and distinctions:

FeatureV. alginolyticus NQRM. aquaeolei NQRSignificance
Subunit compositionAlpha, beta, gamma subunitsMultiple subunits including EEvolutionary adaptation
Na+ dependencyStrict Na+ dependenceSimilar Na+ dependence expectedConserved ion-coupling mechanism
Inhibitor sensitivityStrongly inhibited by HQNOLikely similar inhibition profileConserved active site structure
Quinone reductionTwo-step: semiquinone intermediateLikely similar mechanismConserved electron transfer pathway
Genomic contextSingle enzyme typeTwo types: Na+-dependent and Na+-independentEnhanced metabolic flexibility

The presence of both Na+-dependent and Na+-independent NADH-quinone reductases in M. aquaeolei suggests a more versatile respiratory chain compared to V. alginolyticus . This versatility likely contributes to M. aquaeolei's remarkable adaptability across diverse marine environments. Research using comparative genomics and proteomics approaches would further elucidate the evolutionary relationships between these enzymes and their specialized adaptations.

What role does the NQR complex play in M. aquaeolei's ability to thrive in diverse marine environments?

The NQR complex plays a pivotal role in M. aquaeolei's remarkable environmental adaptability. Genomic analysis reveals that M. aquaeolei VT8 possesses an exceptionally versatile metabolic repertoire . The NQR complex contributes to this versatility through several mechanisms:

  • Bioenergetic flexibility: The ability to use Na+ gradients for energy conservation provides an alternative to proton-based energy conservation, particularly advantageous in high-salt environments.

  • Redox balance maintenance: As part of the electron transport chain, NQR helps maintain cellular redox balance during various metabolic activities, including hydrocarbon degradation.

  • Integration with diverse metabolic pathways: M. aquaeolei possesses "four variations of the TCA cycle, complete pathways of glycolysis and the degradation of more complex hydrocarbons... alternative phosphorous and nitrogen sources, genes for the use of nitrate and sulfate as electron acceptors as well as complete pathways for sulfite oxidation, denitrification and iron oxidation" .

  • Biofilm formation support: The energy provided by NQR supports biofilm formation processes, which are critical for M. aquaeolei's interactions with various surfaces and potentially with other organisms .

The NQR complex thus represents one component of an integrated metabolic network that allows M. aquaeolei to function as what researchers have termed a biogeochemical "opportunitroph" , capable of exploiting diverse environmental niches.

What are the most effective strategies for site-directed mutagenesis of key residues in NQR subunit E?

Site-directed mutagenesis of NQR subunit E requires careful planning and execution due to the membrane-bound nature of this protein. The following methodological approach is recommended:

  • Target selection: Based on sequence alignments with homologous proteins, identify conserved residues likely involved in:

    • Cofactor binding (potential histidine, cysteine residues for metal coordination)

    • Na+ binding sites (typically involving acidic residues)

    • Transmembrane regions (hydrophobic stretches)

    • Protein-protein interaction interfaces between subunits

  • Mutagenesis technique selection:

    • For single mutations: QuikChange site-directed mutagenesis

    • For multiple mutations: Gibson Assembly or golden gate cloning

    • For scanning mutagenesis: Alanine-scanning libraries

  • Validation strategies:

    • Expression verification: Western blotting with subunit-specific antibodies

    • Structural integrity: Circular dichroism spectroscopy

    • Activity assays: As described in question 1.4

    • Protein-protein interaction: Crosslinking studies and co-immunoprecipitation

  • Analysis of mutant phenotypes:

    • Kinetic parameters (Km, Vmax) for NADH oxidation

    • Na+ dependency curves

    • Inhibitor sensitivity profiles

    • Thermostability measurements

This systematic approach allows for structure-function correlation and identification of key residues involved in catalysis, ion transport, and quaternary structure formation.

How can researchers effectively integrate recombinant NQR into proteoliposomes for bioenergetic studies?

Reconstituting recombinant NQR into proteoliposomes represents a sophisticated approach for studying the enzyme's bioenergetic functions. The following methodological workflow is recommended:

  • Lipid composition optimization:

    • Use bacterial lipid extracts or defined mixtures mimicking bacterial membranes

    • Include phosphatidylcholine, phosphatidylethanolamine, and cardiolipin

    • Maintain proper lipid-to-protein ratios (typically 50:1 to 100:1 by weight)

  • Reconstitution techniques:

    • Detergent-mediated reconstitution: Gradually remove detergent using Bio-Beads or dialysis

    • Direct incorporation during liposome formation: Using techniques like freeze-thaw cycles

    • Microfluidic-based formation: For more uniform proteoliposome size distribution

  • Functional validation:

    • Confirm protein orientation using protease protection assays

    • Measure NADH oxidation activity using membrane-impermeable electron acceptors

    • Quantify Na+ transport using sodium-sensitive fluorescent dyes

  • Bioenergetic measurements:

    • Membrane potential generation: Measure using voltage-sensitive dyes like DiSC3(5)

    • Na+ gradient formation: Quantify using 22Na+ uptake or sodium-sensitive indicators

    • Coupling efficiency: Determine the ratio of Na+ transported per NADH oxidized

This approach enables detailed investigation of the enzyme's ion-translocating capabilities and bioenergetic efficiency, providing insights into its role in bacterial energy conservation mechanisms.

How can recombinant M. aquaeolei NQR contribute to bioremediation technology development?

Recombinant M. aquaeolei NQR has significant potential applications in bioremediation technologies, particularly for hydrocarbon-contaminated marine environments. M. aquaeolei has been identified as a hydrocarbon degrader capable of functioning in various marine habitats with extreme pH or salinity conditions . The NQR complex contributes to this capability by providing bioenergetic support for metabolic processes.

Research applications include:

  • Engineered bioremediation systems: Recombinant expression of M. aquaeolei NQR in other bacteria could enhance their bioenergetic capabilities in saline environments, improving bioremediation efficiency.

  • Biosensor development: NQR-based systems could be developed to detect pollutants that affect respiratory chain function in marine bacteria.

  • Biofilm engineering: Understanding NQR's role in biofilm formation could lead to enhanced biofilm-based bioremediation technologies. M. aquaeolei produces "thick biofilms around metals that it interacts with" and possesses genes for "type IV pili [that] serve in biofilm formation" and potentially function as "nanowires for extracellular electron transfer" .

  • Integration with other biodegradation pathways: M. aquaeolei possesses "complete pathways of glycolysis and the degradation of more complex hydrocarbons (including octane oxidation and cyclohexanol degradation)" , which could be optimized for specific contaminant remediation when coupled with efficient energy conservation through NQR.

Methodologically, these applications require detailed understanding of enzyme stability under various environmental conditions and optimization of expression systems for field applications.

What approaches can be used to study the evolution of Na+-translocating NQR in marine bacteria?

Studying the evolution of Na+-translocating NQR in marine bacteria requires a multifaceted approach combining genomics, biochemistry, and ecological perspectives:

  • Comparative genomics:

    • Analyze NQR gene clusters across diverse marine bacteria

    • Identify conserved and variable regions suggesting functional adaptation

    • Examine horizontal gene transfer patterns by analyzing GC content and codon usage bias

  • Phylogenetic analysis:

    • Construct phylogenetic trees of NQR subunits across marine bacteria

    • Compare with 16S rRNA phylogeny to identify potential horizontal transfer events

    • Analyze selection pressure (dN/dS ratios) on different subunits

  • Structural biology integration:

    • Compare predicted structural models across diverse species

    • Identify conserved structural elements suggesting functional constraints

    • Map evolutionary changes onto structural models to understand adaptive mutations

  • Environmental correlation:

    • Analyze NQR distribution in relation to oceanic conditions (salinity, temperature, depth)

    • Examine environmental metagenomes for NQR variants

    • Correlate NQR gene presence with specific ecological niches

Evidence suggests that genes like "alkane 1-monooxygenase, appear to have originated from lateral gene transfer as they are located on gene clusters of 10-20% lower GC-content compared to genome averages and are flanked by transposases" . Similar analyses could reveal whether NQR genes show evolutionary patterns indicative of lateral transfer or niche adaptation.

How can structural biology techniques be optimized for membrane-bound respiratory enzymes like NQR?

Structural characterization of membrane proteins like NQR presents significant challenges requiring specialized approaches:

Methodological innovations could include:

  • Using styrene-maleic acid lipid particles (SMALPs) to extract membrane proteins with their native lipid environment

  • Employing computational approaches like AlphaFold2 to predict structures and guide experimental design

  • Combining complementary techniques (e.g., cryo-EM with distance restraints from crosslinking MS) for hybrid structural determination

These approaches would provide crucial insights into NQR's structure-function relationships, including the organization of electron transfer cofactors and the mechanism of Na+ translocation.

What strategies can enhance heterologous expression yield of functional NQR complexes?

Heterologous expression of functional membrane protein complexes like NQR presents significant challenges. Advanced methodological strategies include:

  • Host strain engineering:

    • Develop expression hosts with modified membrane composition

    • Incorporate rare codon tRNAs for genes with unusual codon usage

    • Delete proteases that might degrade overexpressed membrane proteins

    • Engineer chaperone systems specialized for membrane protein folding

  • Vector and promoter optimization:

    • Use tunable promoters to control expression rate

    • Develop multi-promoter systems for balanced expression of all subunits

    • Incorporate post-transcriptional regulatory elements for expression fine-tuning

    • Design operon structures mimicking native gene organization

  • Folding and assembly optimization:

    • Include specific lipids required for proper folding and assembly

    • Co-express molecular chaperones specific for membrane proteins

    • Develop slow induction protocols at reduced temperatures (16-20°C)

    • Incorporate chemical chaperones in growth media

  • High-throughput optimization:

    • Design parallel expression screening platforms

    • Develop activity-based selection systems

    • Use computational design to predict stabilizing mutations

    • Apply directed evolution approaches to enhance stability and expression

Learning from successful approaches with similar complexes, such as those used in engineering hydrocarbon tolerance in E. coli using genes from M. aquaeolei , could provide valuable insights for NQR expression optimization.

How can researchers address stability issues with purified recombinant NQR subunit E?

Stability challenges with purified membrane proteins like NQR subunit E require systematic troubleshooting approaches:

  • Buffer optimization:

    • Screen pH ranges (typically 6.5-8.5)

    • Test various salt concentrations (100-500 mM)

    • Include stabilizing additives (glycerol 10-20%, sucrose 5-15%)

    • Add specific lipids that may enhance stability (phosphatidylcholine, cardiolipin)

    • Evaluate various detergents beyond initial solubilization (DDM, LMNG, GDN)

  • Covalent modification prevention:

    • Include reducing agents (DTT, TCEP) to prevent disulfide formation

    • Add chelators (EDTA) to prevent metal-catalyzed oxidation

    • Work under argon/nitrogen atmosphere for oxygen-sensitive preparations

    • Include protease inhibitors to prevent degradation

  • Storage and handling protocols:

    • Determine optimal protein concentration (typically 1-5 mg/ml)

    • Test flash-freezing in liquid nitrogen versus gradual cooling

    • Evaluate additives that prevent freeze-thaw damage

    • Determine optimal storage temperature (-80°C, -20°C, 4°C)

  • Stability monitoring techniques:

    • Use thermal shift assays to identify stabilizing conditions

    • Monitor time-dependent activity loss under various conditions

    • Apply light scattering techniques to detect aggregation

    • Employ limited proteolysis to identify stable domains

These systematic approaches can significantly improve protein stability, enabling more reliable structural and functional studies.

What are effective strategies for analyzing the interaction between NQR and the cellular membrane environment?

Understanding NQR-membrane interactions requires specialized approaches that can probe protein-lipid interactions within the native-like environment:

  • Lipid interaction analysis:

    • Lipidomics of co-purified lipids to identify tightly bound species

    • Fluorescence anisotropy with labeled lipids to measure binding affinities

    • Deuterium exchange mass spectrometry to identify membrane-interacting regions

    • Molecular dynamics simulations to predict protein-lipid interactions

  • Membrane dynamics effects:

    • Fluorescence recovery after photobleaching (FRAP) to measure lateral mobility

    • Electron paramagnetic resonance (EPR) with spin-labeled lipids to assess membrane fluidity

    • Atomic force microscopy to visualize protein organization in membranes

    • Solid-state NMR to measure membrane thickness changes near the protein

  • Functional impact assessment:

    • Systematic activity assays with defined lipid compositions

    • Electrophysiological measurements in planar lipid bilayers

    • Proton/sodium leak measurements in proteoliposomes

    • Thermal stability analysis in different membrane environments

  • In vivo approaches:

    • Fluorescence localization studies using GFP-tagged constructs

    • Biofilm formation analysis with lipid composition mutants

    • Membrane microdomain co-localization using specific markers

    • In vivo crosslinking to identify neighboring membrane components

These methodologies provide crucial insights into how the membrane environment modulates NQR function and how the enzyme might be optimized for various biotechnological applications.

What emerging technologies could revolutionize research on membrane-bound respiratory complexes like NQR?

Several cutting-edge technologies hold promise for transforming research on membrane-bound respiratory complexes like NQR:

  • Structural biology advances:

    • Cryo-electron tomography for in situ structural determination

    • Micro-electron diffraction for structure determination from nano-crystals

    • Integrative structural biology combining multiple data sources

    • AI-powered structure prediction tools like AlphaFold for membrane proteins

  • Single-molecule techniques:

    • High-speed atomic force microscopy for real-time conformational dynamics

    • Single-molecule FRET to track distance changes during catalysis

    • Nanopore recording of individual enzyme complexes

    • Single-molecule mass photometry for heterogeneity analysis

  • Advanced spectroscopy:

    • Ultra-fast time-resolved spectroscopy to capture transient intermediates

    • Two-dimensional electronic spectroscopy for energy transfer mapping

    • Advanced EPR techniques (HYSCORE, ELDOR, DEER) for distance measurements

    • Surface-enhanced Raman spectroscopy for local environment sensing

  • Genetic and cellular tools:

    • CRISPR-based precise genome editing for in vivo studies

    • Optogenetic control of respiratory complex activity

    • Expanded genetic code incorporation for site-specific probes

    • Synthetic cell-like systems with defined membrane composition

These technologies promise to provide unprecedented insights into the dynamic function of NQR and similar complexes, potentially leading to novel applications in bioenergetics, synthetic biology, and biotechnology.

How might understanding of the NQR complex contribute to synthetic biology applications?

The Na(+)-translocating NADH-quinone reductase complex offers unique properties that could be harnessed for various synthetic biology applications:

  • Alternative bioenergetic modules:

    • Creation of synthetic organisms using sodium-based bioenergetics instead of proton-based systems

    • Development of hybrid energy conservation systems combining different ion gradients

    • Design of artificial electron transport chains with novel cofactor arrangements

    • Engineering of salt-tolerant biocatalysts for industrial applications

  • Bioelectrochemical systems:

    • Development of microbial fuel cells optimized for saline conditions

    • Creation of biosensors based on NQR activity

    • Engineering of electron transfer systems between organisms and electrodes

    • Design of bioelectrosynthesis platforms using sodium gradients

  • Metabolic engineering applications:

    • Optimization of redox balance in engineered metabolic pathways

    • Creation of synthetic methylotrophy using NQR for energy conservation

    • Engineering of artificial CO2 fixation pathways coupled to NQR

    • Development of synthetic organisms for enhanced bioremediation

  • Minimal cell approaches:

    • Incorporation of NQR into minimal respiratory chains

    • Development of artificial cells with simplified bioenergetic systems

    • Creation of modular bioenergetic components for synthetic biology

    • Engineering of adaptable energy conservation systems for various environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.