Recombinant Marinobacter aquaeolei Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant UbiB is expressed in E. coli or other host systems and purified for biochemical research. It corresponds to the full-length protein (547 amino acids) encoded by the ubiB gene (locus: Maqu_3417) in M. aquaeolei VT8 . Key characteristics include:

PropertyDetail
Uniprot IDA1U669
Molecular Weight~60 kDa (calculated)
Expression RegionAmino acids 1–547
TagN-/C-terminal tag (determined during production)
Storage-20°C in Tris-based buffer with 50% glycerol; avoid repeated freeze-thaw
Purity>85% (SDS-PAGE verified)

Functional Role in Ubiquinone Biosynthesis

UbiB belongs to the UbiB kinase-like family, which is universally conserved in prokaryotes and eukaryotes and essential for coenzyme Q (CoQ) biosynthesis . Key functional insights include:

  • Mechanistic Role: UbiB facilitates the first monooxygenation step in CoQ synthesis, likely via ATP hydrolysis-driven stabilization of biosynthetic enzyme complexes .

  • Structural Features: Despite kinase-like folds, UbiB’s active site is sterically hindered, suggesting non-catalytic regulatory roles (e.g., substrate shuttling or membrane interaction) .

  • Genetic Context: In M. aquaeolei, the ubiB gene is part of a genomic cluster enriched in hydrocarbon degradation and redox metabolism genes, reflecting adaptive traits for oil-polluted environments .

3.1. Biochemical Studies

Recombinant UbiB is used to:

  • Investigate ATPase activity under varying lipid membrane conditions .

  • Characterize interactions with CoQ intermediates and cardiolipin-containing membranes .

  • Study horizontal gene transfer impacts on metabolic versatility (e.g., hydrocarbon oxidation) .

3.2. Industrial Relevance

  • Bioremediation: M. aquaeolei’s UbiB-linked pathways enable degradation of oil-derived compounds (e.g., octane, toluene) .

  • Biotechnology: Engineered UbiB variants could optimize microbial CoQ production for pharmaceuticals .

Comparative Genomic Insights

Genomic analysis of M. aquaeolei VT8 reveals:

  • Metabolic Flexibility: Capability to utilize oxygen, nitrate, and hydrocarbons, supported by horizontally acquired genes near ubiB .

  • Ecological Adaptations: Stress-response systems (e.g., heavy metal resistance, phage defense) co-occur with ubiB, enhancing survival in extreme niches .

Future Directions

  • Mechanistic Studies: Resolving UbiB’s atomic structure and ATPase activation mechanisms .

  • Synthetic Biology: Leveraging M. aquaeolei’s genetic toolkit for bioengineering CoQ-overproducing strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please specify them in your order remarks. We will then prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; Maqu_3417; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-547
Protein Length
full length protein
Species
Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)
Target Names
ubiB
Target Protein Sequence
MTRLQRLFRIAWVFCRYRLDTFLPLSELPTPLKIFFLLAPWHLFPQPKLSRGDRLRLALE ELGPVFVKFGQILSTRRDLLPDDMAESLKQLQDRVPPFPSEQARGIIEKSLGAPVSELFA EFSPDPMASASVAQVHAATLPNGQKVVVKVLRPGIEKVIRQDLGLMYLMAGLLEKYWSEG KRLHPVEVVADYDSTIHDELDLQREAANASQLRRNFENSPLIYIPFIDWDYTRKSVLVME RIHGIPIADVPALEKAGVNMRVLAEKGVEIFFTQVFRDSFFHADMHPGNIFVDVSNPADP KYIAIDFGIVGTLAPDDQSYLARNLLAFFRRDYRQVAQLHIQSGWVPPETRVNEFEAAIR TVCEPIFERPLKDISFGHFLLRLFQTARRFNMEVQPQLVLLQKTLLNVEGLGRQLYPDLD LWSTAQPFLEDWMRKRIGPSGLIKSLQNHLPSWLEQSPEMPQLVHDALLQIRSSGPTEAQ NRATLALMKEQQLRSERRWRRGFIALVLAGAALVGSQPHAGQWLADLPVWSWALLAGAAG VMLRGSR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which plays a role in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Marinobacter aquaeolei and what ecological niche does it occupy?

Marinobacter aquaeolei is one of the most ubiquitous bacterial genera in marine environments. Members of this genus are found throughout the ocean water column, in the deep sea, and are frequently associated with hydrothermal plume particles and marine snow. The strain M. aquaeolei VT8 was isolated from an oil well in Southern Vietnam and has evolved extensive metabolic versatility, earning it the classification as a "biogeochemical opportunotroph." This organism demonstrates remarkable adaptability, exhibiting extremophilic traits including psychrophily (cold tolerance), oligotrophy (survival in nutrient-poor conditions), and halotolerance (salt tolerance) .

M. aquaeolei VT8 is a facultative anaerobe capable of utilizing diverse carbon sources. Its genomic analysis has revealed exceptional metabolic flexibility, including four variations of the TCA cycle, complete pathways for glycolysis, and mechanisms for degrading complex hydrocarbons such as octane oxidation and cyclohexanol degradation. Additionally, the organism can utilize alternative phosphorus and nitrogen sources and possesses genes for employing nitrate and sulfate as electron acceptors. Its metabolic versatility is further evidenced by complete pathways for sulfite oxidation, denitrification, and iron oxidation .

What is the UbiB protein and what is its proposed function in Marinobacter aquaeolei?

The UbiB protein in Marinobacter aquaeolei belongs to the UbiB family, which is characterized by a protein kinase-like (PKL) domain. This family has been recently implicated in mitochondrial membrane homeostasis across various organisms . The protein is classified as a "probable ubiquinone biosynthesis protein," suggesting its involvement in the biosynthetic pathway of ubiquinone (Coenzyme Q), a critical component of the electron transport chain in cellular respiration.

While the exact function of M. aquaeolei UbiB remains under investigation, research on homologous proteins in other organisms indicates potential roles in phospholipid homeostasis and regulation of coenzyme Q distribution . The conserved protein kinase-like domain suggests possible enzymatic activity, although the specific substrates and biochemical reactions catalyzed remain to be fully elucidated. Recent studies of UbiB family members in yeast (such as Cqd1) have demonstrated their importance in forming novel membrane contact sites and maintaining mitochondrial morphology and architecture .

What are the optimal conditions for expression and purification of recombinant M. aquaeolei UbiB protein?

The expression and purification of recombinant M. aquaeolei UbiB protein requires careful optimization of several parameters to ensure high yield and functional integrity. While the search results don't provide specific expression protocols for this particular protein, general methodological principles for bacterial membrane proteins can be applied, with adaptations based on related UbiB family proteins.

A typical expression protocol would involve:

  • Vector Selection: Choosing an appropriate expression vector with an inducible promoter system (such as pET or pBAD) and a purification tag that doesn't interfere with protein function

  • Host Selection: E. coli strains BL21(DE3), C41(DE3), or C43(DE3) are commonly used for membrane protein expression due to their ability to tolerate potentially toxic membrane proteins

  • Growth Conditions:

    • Culture medium: Rich media (LB) or minimal media depending on downstream applications

    • Temperature: Lower induction temperatures (16-25°C) often improve folding of membrane proteins

    • Induction time: 4-16 hours, optimized based on preliminary expression tests

  • Purification Strategy:

    • Membrane isolation via ultracentrifugation

    • Detergent solubilization (common detergents include DDM, LMNG, or Triton X-100)

    • Affinity chromatography using the fusion tag

    • Size exclusion chromatography for final polishing

  • Buffer Optimization:

    • Final storage in Tris-based buffer with 50% glycerol at pH 7.5-8.0

    • Addition of stabilizing agents if necessary

Researchers should conduct small-scale expression tests to determine the optimal induction parameters for their specific construct before scaling up to preparative amounts.

How can I design effective genetic manipulation experiments involving the ubiB gene in M. aquaeolei?

Based on established genetic manipulation methods for M. aquaeolei VT8, the following approach can be implemented for ubiB gene studies:

  • Conjugation-based Gene Transfer: The conjugation procedure for M. aquaeolei VT8 has been established and can be effectively used to introduce foreign DNA. This process involves mixing donor E. coli WM3064 cells containing the desired plasmid with recipient M. aquaeolei VT8 cells at a ratio of 1:3. The mixture is then spotted onto LB plates containing diaminopimelic acid (DAP) and incubated at 30°C for approximately 24 hours .

  • Deletion Mutant Construction: For ubiB gene deletion, construct a plasmid vector containing:

    • Mobilization element from pBBR1MCS-2

    • PCR-amplified regions flanking the ubiB gene

    • Kanamycin resistance cassette placed between the flanking regions to replace the target gene upon double homologous recombination

  • Selection and Verification:

    • After conjugation, collect cells, wash with LB broth, and plate on selective media (LB with kanamycin, without DAP)

    • Incubate at 30°C for 2-4 days

    • Verify deletions by PCR using primers that flank the manipulated DNA regions

  • Advanced Deletion Strategies: For more sophisticated genetic manipulations, consider using a counterselection system involving the sacB gene, which confers sensitivity to sucrose. This allows for the selection of double recombination events and the removal of the plasmid backbone .

Table 1: Key Components for M. aquaeolei Genetic Manipulation

ComponentDescriptionFunction
pBBR1MCS-2Broad-host-range vectorSource of mobilization element
E. coli WM3064DAP-auxotrophic donor strainDelivery vehicle for plasmid transfer
Kanamycin cassetteAntibiotic resistance markerSelection of recombinants
sacB geneLevansucrase from B. subtilisCounterselection marker for sucrose sensitivity
Flanking regions500-1000 bp sequencesDirect homologous recombination

What analytical techniques are most effective for studying UbiB protein interactions and function?

Investigating the interactions and functions of UbiB protein requires a multi-faceted analytical approach. Based on studies of related UbiB family proteins, the following techniques have proven effective:

  • Site-directed Mutagenesis: Generate point mutations in conserved amino acid residues within the protein kinase-like domain (such as K275A, D288A, and E330A) to disrupt ATP binding and assess functional consequences. This approach has been successfully employed with related UbiB family members like Cqd2 and Coq8 .

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation (Co-IP) to identify interacting partners

    • Proximity-dependent biotin identification (BioID) to map the protein interaction network

    • Fluorescence resonance energy transfer (FRET) to visualize interactions in real-time

  • Subcellular Localization:

    • Immunofluorescence microscopy with specific antibodies

    • Expression of fluorescently tagged UbiB to track localization

    • Subcellular fractionation followed by western blotting

  • Functional Assays:

    • Ubiquinone quantification via HPLC or LC-MS

    • Membrane potential measurements using potential-sensitive dyes

    • ATP binding/hydrolysis assays to assess enzymatic activity

  • Structural Analysis:

    • X-ray crystallography or cryo-EM for high-resolution structure determination

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to study protein dynamics

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

The integration of these techniques provides a comprehensive understanding of UbiB's function, interaction partners, and role in cellular processes.

How does UbiB contribute to the metabolic versatility of M. aquaeolei, and what experimental approaches can elucidate this relationship?

The UbiB protein likely plays a crucial role in supporting M. aquaeolei's remarkable metabolic versatility, particularly through its involvement in ubiquinone biosynthesis. Ubiquinone (Coenzyme Q) is a central component of respiratory electron transport chains and serves as an electron carrier in both aerobic and anaerobic respiration.

To investigate this relationship, researchers can employ several experimental approaches:

  • Comparative Metabolomics:

    • Compare metabolite profiles between wild-type and ubiB-deleted strains using LC-MS/MS

    • Focus on intermediates in the ubiquinone biosynthesis pathway

    • Analyze changes in respiratory chain components and energy metabolites

  • Transcriptomic Analysis:

    • Perform RNA-Seq to identify genes differentially expressed in response to ubiB deletion

    • Map changes to specific metabolic pathways using pathway enrichment analysis

    • Identify potential compensatory mechanisms activated in the absence of UbiB

  • Growth Studies Under Varied Conditions:

    • Test growth capabilities of wild-type vs. ubiB-deleted strains under different:

      • Carbon sources (including complex hydrocarbons)

      • Electron acceptors (O₂, NO₃⁻, SO₄²⁻, Fe³⁺)

      • Environmental stressors (temperature, pH, salinity)

    • Quantify growth rates, lag phases, and maximum cell densities

  • Stable Isotope Probing:

    • Use ¹³C-labeled substrates to track carbon flux through metabolic pathways

    • Compare incorporation patterns between wild-type and ubiB-deleted strains

    • Identify metabolic bottlenecks resulting from UbiB deficiency

Given M. aquaeolei's genomic capabilities, including four variations of the TCA cycle and complete pathways for hydrocarbon degradation , the UbiB protein may serve as a crucial link between these diverse metabolic modules, potentially enabling rapid adaptation to changing environmental conditions.

What is the relationship between UbiB and membrane dynamics in M. aquaeolei, and how can this be experimentally investigated?

Studies on UbiB family members in other organisms suggest that these proteins play important roles in membrane dynamics and homeostasis . In the case of M. aquaeolei UbiB, its involvement in ubiquinone biosynthesis likely connects it to membrane function, as ubiquinone is a membrane-embedded electron carrier.

To investigate this relationship, researchers can employ several sophisticated approaches:

  • Membrane Contact Site Analysis:

    • Super-resolution microscopy (STORM, PALM) to visualize potential UbiB-mediated membrane contacts

    • Proximity labeling methods (APEX2, TurboID) to identify proteins in close proximity to UbiB

    • Electron microscopy to examine ultrastructural membrane changes in ubiB mutants

  • Lipid Composition Analysis:

    • Lipidomics using mass spectrometry to profile changes in membrane lipid composition

    • Monitoring phospholipid turnover using radioisotope labeling

    • Fluorescent lipid probes to track lipid distribution in live cells

  • Membrane Property Assessments:

    • Fluorescence anisotropy to measure membrane fluidity

    • Laurdan generalized polarization to assess membrane order

    • Atomic force microscopy to examine mechanical properties of isolated membranes

  • Protein Mobility Studies:

    • Fluorescence recovery after photobleaching (FRAP) to measure protein diffusion rates

    • Single-particle tracking to monitor individual protein movement within membranes

    • Blue native PAGE to analyze respiratory supercomplex assembly

Research on the UbiB family member Cqd1 has revealed its involvement in a novel membrane contact site formation, contributing to phospholipid homeostasis and coenzyme Q distribution . Similar roles might be present in M. aquaeolei UbiB, potentially facilitating interactions between different membrane systems critical for the organism's metabolic flexibility.

How can systems biology approaches be applied to understand UbiB's role in the adaptive responses of M. aquaeolei to environmental changes?

M. aquaeolei's classification as a "biogeochemical opportunotroph" suggests that its adaptive responses to environmental changes involve complex, interconnected regulatory networks. UbiB, through its role in ubiquinone biosynthesis and potential involvement in membrane dynamics, likely serves as a key node in these networks.

Systems biology approaches to investigate this include:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, metabolomics, and lipidomics data from wild-type and ubiB-deleted strains under various environmental conditions

    • Apply computational methods to construct gene regulatory networks and identify key control points

    • Use Bayesian network analysis to infer causal relationships between UbiB activity and downstream adaptive responses

  • Genome-scale Metabolic Modeling:

    • Construct a genome-scale metabolic model of M. aquaeolei

    • Perform in silico gene knockouts to predict the metabolic consequences of ubiB deletion

    • Use flux balance analysis to identify critical pathways affected by UbiB activity under different environmental scenarios

  • Environmental Simulation Experiments:

    • Design bioreactors to simulate environmental transitions relevant to M. aquaeolei's natural habitat

    • Monitor real-time physiological responses using biosensors for key metabolites

    • Compare dynamic adaptation profiles between wild-type and ubiB-deleted strains

  • Network Perturbation Analysis:

    • Apply targeted inhibitors or activators of pathways connected to UbiB function

    • Use time-series analysis to track propagation of perturbation effects through the metabolic network

    • Identify compensatory mechanisms and feedback loops involved in maintaining homeostasis

Table 2: Systems Biology Approaches for Studying UbiB Function

ApproachTechniquesExpected Insights
GenomicsWhole genome sequencing, Comparative genomicsEvolutionary context of UbiB, Genetic variations
TranscriptomicsRNA-Seq, qRT-PCRGene expression changes, Regulatory networks
ProteomicsLC-MS/MS, PhosphoproteomicsProtein abundance changes, Post-translational modifications
MetabolomicsGC-MS, LC-MS, NMRMetabolic flux alterations, Pathway activities
LipidomicsMass spectrometry-based lipid profilingMembrane composition changes, Lipid metabolism
Computational modelingFlux balance analysis, Kinetic modelingPredictive simulations, Hypothesis generation

How does M. aquaeolei UbiB compare to UbiB family proteins in other organisms, and what insights can be gained from these comparisons?

UbiB family proteins are highly conserved across diverse organisms, suggesting fundamental roles in cellular function. Comparative analysis between M. aquaeolei UbiB and its homologs can provide valuable insights into evolutionary adaptations and functional conservation.

The UbiB family is defined by the presence of a protein kinase-like (PKL) domain with unknown function . In yeast, the UbiB family member Cqd1 has been implicated in phospholipid homeostasis and coenzyme Q distribution, contributing to membrane contact site formation . Similar roles might be conserved in M. aquaeolei UbiB, though potentially adapted to the unique ecological niche of this marine bacterium.

Experimental approaches for comparative analysis include:

  • Phylogenetic Analysis:

    • Construct phylogenetic trees of UbiB proteins across bacterial, archaeal, and eukaryotic lineages

    • Identify conserved motifs and residues that may be critical for function

    • Correlate evolutionary divergence with ecological adaptations

  • Complementation Studies:

    • Express M. aquaeolei UbiB in UbiB-deficient strains of model organisms (E. coli, yeast)

    • Assess whether the bacterial protein can rescue phenotypes associated with UbiB deficiency

    • Identify functional domains through domain-swapping experiments

  • Structural Comparison:

    • Generate homology models based on available structures of related proteins

    • Compare ATP-binding sites and potential catalytic residues

    • Identify structural features unique to M. aquaeolei UbiB that might reflect specialized functions

  • Biochemical Activity Comparison:

    • Express and purify UbiB homologs from diverse organisms

    • Compare enzymatic activities, substrate specificities, and kinetic parameters

    • Assess responses to environmental factors relevant to each organism's niche

These comparative approaches can reveal how the fundamental functions of UbiB proteins have been conserved or modified across evolutionary history to support the diverse metabolic strategies observed in different organisms.

What experimental designs would best elucidate the role of UbiB in M. aquaeolei's adaptation to extreme environments?

M. aquaeolei's ability to thrive in extreme environments, including oil wells and marine settings with varying conditions, suggests that UbiB may play a role in stress adaptation. Investigating this relationship requires carefully designed experiments that simulate relevant environmental stressors.

Effective experimental designs include:

  • Controlled Stress Exposure Studies:

    • Expose wild-type and ubiB-deleted strains to graduated levels of:

      • Hydrocarbon contamination

      • Oxygen limitation

      • Osmotic stress

      • Temperature extremes

      • Nutrient limitation

    • Monitor growth parameters, survival rates, and cellular physiology

    • Use transcriptomics to identify differential stress responses

  • In situ Environmental Simulation:

    • Design bioreactors that mimic conditions found in:

      • Oil wells

      • Marine snow

      • Hydrothermal vent plumes

      • Deep sea environments

    • Compare wild-type and ubiB-deleted strain performance under these complex conditions

    • Measure metabolic activities using isotope labeling and metabolite profiling

  • Competition Experiments:

    • Co-culture wild-type and ubiB-deleted strains under various stress conditions

    • Track population dynamics using strain-specific markers

    • Identify conditions where UbiB confers competitive advantage

  • Evolutionary Adaptation Studies:

    • Subject wild-type and ubiB-deleted strains to long-term growth under selective pressure

    • Sequence evolved populations to identify compensatory mutations

    • Characterize phenotypic changes and fitness improvements

Table 3: Environmental Stress Parameters for Experimental Testing

Environmental StressExperimental RangeMeasurement Parameters
Hydrocarbon exposure0.1-10% crude oilGrowth rate, hydrocarbon degradation efficiency
Oxygen limitation0-21% O₂Respiratory quotient, redox balance markers
Salinity0.5-15% NaClOsmoprotectant production, membrane integrity
Temperature4-50°CHeat/cold shock protein expression, growth rates
pHpH 4-10Membrane potential, intracellular pH regulation
Nutrient limitationC:N:P ratiosStorage compound accumulation, scavenging enzyme production

What are the potential biotechnological applications of recombinant M. aquaeolei UbiB, and how can research be designed to explore these possibilities?

Given M. aquaeolei's remarkable metabolic versatility and the UbiB protein's probable role in ubiquinone biosynthesis and membrane homeostasis, several biotechnological applications can be envisioned:

  • Bioremediation Enhancement:

    • Engineer strains with optimized UbiB expression for improved hydrocarbon degradation

    • Research design: Compare pollutant removal efficiency between wild-type, ubiB-deleted, and UbiB-overexpressing strains in simulated oil spill environments

    • Measurement endpoints: Degradation rates, intermediate metabolite profiles, and microbial community interactions

  • Ubiquinone (Coenzyme Q) Production:

    • Develop bioproduction systems using engineered M. aquaeolei strains

    • Research design: Metabolic engineering approaches to redirect carbon flux toward ubiquinone biosynthesis, potentially by manipulating UbiB and related pathway components

    • Optimization parameters: Media composition, feeding strategies, and downstream processing methods

  • Membrane Protein Expression Systems:

    • Exploit M. aquaeolei's membrane adaptability for heterologous protein expression

    • Research design: Develop expression vectors utilizing UbiB-associated promoters for environment-responsive protein production

    • Validation methods: Protein yield quantification, functional assays, and membrane integration analysis

  • Biosensor Development:

    • Create UbiB-based biosensors for environmental monitoring

    • Research design: Engineer fusion proteins linking UbiB domains to reporter systems that respond to specific environmental stimuli

    • Performance metrics: Sensitivity, specificity, response time, and signal stability

To explore these applications, research should progress from fundamental mechanistic studies to proof-of-concept experiments and finally to prototype development and field testing.

What methodological challenges exist in studying UbiB function, and how can researchers overcome these limitations?

The study of UbiB protein function presents several methodological challenges that require innovative approaches to overcome:

  • Membrane Protein Solubility and Stability:

    • Challenge: UbiB is likely a membrane-associated protein, making it difficult to express, purify, and maintain in a functional state

    • Solutions:

      • Optimize detergent selection through systematic screening of different detergent classes

      • Explore nanodiscs, amphipols, or styrene-maleic acid copolymer lipid particles (SMALPs) as alternative membrane mimetics

      • Consider fusion partners that enhance solubility while maintaining function

  • Enzymatic Activity Characterization:

    • Challenge: The specific enzymatic activity of UbiB remains poorly defined

    • Solutions:

      • Develop high-throughput screening assays for potential substrates

      • Utilize chemical biology approaches with activity-based probes

      • Implement unbiased metabolomics to identify changes associated with UbiB activity or deletion

  • Physiological Relevance of in vitro Findings:

    • Challenge: Translating biochemical observations to cellular function

    • Solutions:

      • Develop cell-based assays that monitor UbiB-dependent processes

      • Use genetic complementation with mutant variants to correlate biochemical properties with cellular phenotypes

      • Implement inducible expression systems to study dose-dependent effects

  • Technical Difficulties in M. aquaeolei Manipulation:

    • Challenge: Limited genetic tools compared to model organisms

    • Solutions:

      • Adapt CRISPR-Cas systems for precise genome editing in M. aquaeolei

      • Develop shuttle vectors with appropriate selectable markers

      • Establish reporter systems optimized for M. aquaeolei

Table 4: Methodological Challenges and Solutions for UbiB Research

ChallengeConventional ApproachAdvanced SolutionExpected Improvement
Protein insolubilityDetergent screeningMembrane scaffold proteins, NanodiscsNative-like environment, improved stability
Low expressionE. coli standard strainsSpecialized strains (Lemo21, C41/C43)Higher yield, reduced toxicity
Unknown activityTargeted enzyme assaysActivity-based protein profilingUnbiased discovery of substrates
Unstable deletion mutantsConstitutive deletionConditional expression systemsTemporal control of gene function
Limited genetic toolsPlasmid-based expressionGenome integration, CRISPR-Cas9Stable expression, precise modifications

What are the most promising future research directions for understanding UbiB's role in ubiquinone biosynthesis and cellular metabolism?

Based on current knowledge and technological capabilities, several promising research directions emerge for advancing our understanding of UbiB's role in ubiquinone biosynthesis and cellular metabolism:

  • Structural Biology Advancements:

    • Apply cryo-electron microscopy to elucidate UbiB's structure in membrane environments

    • Investigate UbiB in complex with potential interaction partners

    • Use molecular dynamics simulations to understand conformational changes associated with function

  • Systems-Level Integration:

    • Map the complete interaction network of UbiB using proximity labeling and mass spectrometry

    • Develop computational models that integrate UbiB function into the broader metabolic network

    • Investigate how UbiB contributes to metabolic flexibility in changing environments

  • Evolutionary and Comparative Studies:

    • Analyze UbiB homologs across diverse bacterial lineages adapted to different ecological niches

    • Investigate how UbiB function has been modified through evolution to support specialized metabolic capabilities

    • Identify unique features of M. aquaeolei UbiB compared to homologs in other organisms

  • Synthetic Biology Applications:

    • Design minimal synthetic pathways incorporating UbiB for ubiquinone production

    • Engineer novel functionalities by domain swapping between UbiB homologs

    • Develop UbiB-based switches for controlling membrane properties in engineered systems

  • Advanced Imaging Approaches:

    • Implement correlative light and electron microscopy to visualize UbiB localization within cellular ultrastructure

    • Use single-molecule tracking to monitor UbiB dynamics in live cells

    • Apply expansion microscopy to resolve UbiB's association with membrane domains

These research directions, pursued in parallel, would provide complementary insights into UbiB function and could lead to both fundamental understanding and practical applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.