Recombinant Marinomonas sp. Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; Mmwyl1_0254; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Marinomonas sp. (strain MWYL1)
Target Names
mtgA
Target Protein Sequence
MAKRKQGIFGRIWFVAWRFLLLFVIVLFLFRFVPLPTTSFMLQSQYPVKHTWISIDKLPT YMPLAVVASEDQRFPDHFGVDFTAISKALDQYDDGDGLRGASTITQQTAKNLFLWSGRSF IRKGLEAGLAIGLETLWGKKRILEVYLNIAEFGKGIYGVEAASQHYFGRSASKLTMNQAA RLAVLLPSPRTRNPNDLTFYLRERVDWVERQMQQLGPDYLKPIIE
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Marinomonas sp. Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)?

Marinomonas sp. Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is an enzyme involved in bacterial cell wall synthesis classified as EC 2.4.2.-. It belongs to a family of transglycosylases that catalyze the polymerization of glycan strands in peptidoglycan biosynthesis. The protein from Marinomonas sp. (strain MWYL1) has a UniProt ID of A6VRW7 and is encoded by the mtgA gene (locus Mmwyl1_0254) . Based on studies of homologous proteins, mtgA functions as a "PG terminase" or "PG release factor," responsible for releasing newly synthesized peptidoglycan strands from undecaprenyl pyrophosphate anchors on the cytoplasmic membrane, making it critical for proper cell wall assembly and integrity . This enzyme is part of the broader class of transglycosylases that prevent toxic crowding of the periplasm with peptidoglycan polymers .

How does mtgA differ from other transglycosylases functionally?

Functionally, mtgA differs from other transglycosylases in several important ways:

  • Classification: As a monofunctional transglycosylase, mtgA performs only glycosyltransferase activity, unlike bifunctional enzymes that also possess transpeptidase activity .

  • Membrane association: MtgA (and homologs like MltG) specifically associates with active peptidoglycan synthetic complexes, suggesting a coordinated role in new cell wall synthesis rather than just remodeling existing peptidoglycan .

  • Release function: Unlike some lytic transglycosylases (LTGs) that primarily degrade peptidoglycan, mtgA functions primarily to release newly synthesized peptidoglycan strands from their lipid carriers, serving as a "peptidoglycan terminase" .

  • Redundancy patterns: Studies in organisms like V. cholerae show that while multiple LTGs can exhibit functional redundancy, MltG (the mtgA homolog) has some unique functions that cannot be fully compensated by other LTGs, particularly under stress conditions .

  • Strand length determination: MltG in E. coli has been shown to be a strong determinant of peptidoglycan strand length, suggesting mtgA may play a similar role in controlling the architecture of the cell wall .

What are the key residues involved in mtgA substrate binding and catalysis?

Based on structural and functional studies of homologous transglycosylases, several key residues are likely critical for mtgA function:

  • Catalytic residues: Studies of S. aureus transglycosylase reveal that residues K140 and R148 in the donor site are essential for enzymatic activity . Similar conserved positively charged residues are likely present in Marinomonas sp. mtgA that stabilize negatively charged reaction intermediates during catalysis.

  • Donor site residues: The donor site must accommodate the lipid II substrate and position it correctly for nucleophilic attack. Conserved aromatic and hydrophobic residues typically form a pocket that interacts with the lipid moiety, while polar residues form hydrogen bonds with the sugar components .

  • Acceptor site residues: This site binds the growing glycan chain, with residues that recognize the terminal GlcNAc-MurNAc disaccharide units and position them for the incoming reaction.

  • Membrane interface residues: Given its association with the membrane, mtgA likely contains a hydrophobic patch or amphipathic helices that interface with the membrane and help position the enzyme relative to its lipid-linked substrate.

To experimentally identify these residues, researchers typically employ:

  • Site-directed mutagenesis focused on conserved residues

  • Activity assays with mutant proteins

  • Structural studies with substrate analogs

  • Molecular dynamics simulations to identify conformational changes during catalysis

How can mtgA be used in studies of peptidoglycan synthesis inhibitors?

Recombinant mtgA provides a valuable tool for developing and studying peptidoglycan synthesis inhibitors:

  • High-throughput screening platform: Purified mtgA can be used to screen compound libraries for inhibitors that specifically target transglycosylase activity. This approach has become increasingly important as bacteria develop resistance to traditional antibiotics targeting transpeptidase activity .

  • Structure-based drug design: The crystal structure of S. aureus transglycosylase in complex with a lipid II analog at 2.3 Å resolution provides a template for structure-based design of inhibitors targeting mtgA and related enzymes . Molecular docking studies can identify compounds predicted to bind to the active site.

  • Mechanism-based inhibitor development: Understanding the catalytic mechanism of mtgA enables the design of transition-state analogs or mechanism-based inhibitors that irreversibly inactivate the enzyme.

  • Validation of target engagement: Recombinant mtgA can be used to confirm that candidate inhibitors directly engage the transglycosylase rather than acting through off-target effects.

  • Resistance studies: By generating mutants resistant to specific inhibitors, researchers can map the inhibitor binding site and predict potential resistance mechanisms that might emerge clinically.

This work is particularly important because while many antibiotics have been developed to target transpeptidase activity, transglycosylases represent an underexploited target for antibiotic development .

What are the challenges in expressing and purifying active recombinant mtgA?

Expressing and purifying active recombinant mtgA presents several significant challenges:

  • Membrane association: As a membrane-associated protein with hydrophobic domains, mtgA is often difficult to express in soluble form . Researchers typically need to optimize:

    • Detergent selection for extraction from membranes

    • Use of fusion partners to enhance solubility

    • Expression as truncated constructs lacking transmembrane domains

  • Stability concerns: The protein may show limited stability outside its native membrane environment, requiring careful buffer optimization. The standard storage buffer typically includes 50% glycerol and a Tris-based buffer system optimized for this specific protein .

  • Expression system selection: E. coli expression systems may not provide proper post-translational modifications or folding environment. Optimization of:

    • Expression temperature (often lowered to improve folding)

    • Induction conditions (typically using lower inducer concentrations)

    • Host strain selection (strains optimized for membrane protein expression)

  • Purification challenges:

    • Tag selection that minimizes interference with enzymatic activity

    • Multi-step purification approaches to achieve high purity

    • Activity verification at each purification step

  • Storage considerations: Repeated freezing and thawing is not recommended for mtgA, as noted in the product information . Working aliquots should be stored at 4°C for up to one week, while long-term storage requires -20°C or -80°C.

These challenges necessitate careful optimization of each step in the expression and purification process to obtain functionally active enzyme suitable for biochemical and structural studies.

How do mutations in mtgA affect bacterial cell wall integrity and antibiotic resistance?

Mutations in mtgA can significantly impact bacterial cell wall integrity and potentially influence antibiotic resistance through several mechanisms:

  • Cell wall architecture alterations: Studies of MltG (mtgA homolog) in E. coli show it strongly determines peptidoglycan strand length . Mutations may lead to:

    • Changes in glycan chain length

    • Altered crosslinking patterns

    • Modifications in cell wall thickness

    • Compromised structural integrity

  • Functional redundancy effects: In V. cholerae, MltG showed synthetic interactions with other lytic transglycosylases (LTGs), where multiple LTG mutant backgrounds revealed phenotypes not observed in single mutants . This suggests:

    • Partial functional redundancy among transglycosylases

    • Compensatory upregulation of other enzymes when mtgA is mutated

    • Strain-specific differences in the importance of mtgA

  • Stress response impacts: The ∆7 LTG mutant in V. cholerae (including mltG deletion) showed hypersensitivity to osmotic stress and MreB inhibitors, indicating that mtgA mutations may reduce bacterial fitness under stress conditions .

  • Antibiotic susceptibility changes: Alterations in peptidoglycan structure can affect:

    • Access of antibiotics to their targets

    • Cell wall permeability to antibiotics

    • Activation of resistance mechanisms

    • Susceptibility to cell wall-targeting antibiotics

  • Peptidoglycan debris accumulation: LTG mutants (including mltG mutants) in V. cholerae showed accumulation of uncrosslinked peptidoglycan material in the periplasm , which could:

    • Create toxic crowding effects

    • Alter signaling related to cell wall stress

    • Influence activation of resistance mechanisms

Understanding these effects requires combining genetic approaches with detailed cell wall analysis and antimicrobial susceptibility testing.

What are the best methods for assessing mtgA enzymatic activity?

Several complementary methods can be employed to assess mtgA transglycosylase activity:

  • Radioactive assays:

    • Principle: Using radiolabeled lipid II substrate and measuring incorporation into polymeric product

    • Advantages: High sensitivity and direct measurement of polymerization

    • Limitations: Safety concerns, specialized facilities required, and waste disposal issues

    • Implementation: Typically uses [14C]-labeled lipid II with paper chromatography or SDS-PAGE separation

  • Fluorescence-based assays:

    • Principle: Employing fluorescently labeled lipid II analogs and monitoring changes during polymerization

    • Advantages: Real-time monitoring capability and compatibility with high-throughput formats

    • Limitations: Potential interference from labeled substrates and background fluorescence

    • Implementation: Microplate format with dansylated or FITC-labeled substrate analogs

  • LC-MS analysis:

    • Principle: Direct analysis of reaction products and substrates by liquid chromatography-mass spectrometry

    • Advantages: Detailed structural information about products and identification of intermediates

    • Limitations: Lower throughput and specialized equipment requirements

    • Implementation: Reaction mixtures are analyzed for depletion of substrate and formation of specific products

  • Coupled enzyme assays:

    • Principle: Linking transglycosylase activity to a secondary reaction with easily detectable output

    • Advantages: Continuous monitoring capability and potential for high throughput

    • Limitations: Interference from coupling enzymes and indirect measurement

    • Implementation: Often couples release of undecaprenyl pyrophosphate to subsequent enzymatic reactions

  • In vivo cell wall labeling:

    • Principle: Using fluorescent D-amino acids (FDAAs) like BADA to label actively synthesized peptidoglycan

    • Advantages: Visualization of activity in native cellular context

    • Limitations: Not a direct measure of isolated mtgA activity

    • Implementation: Similar to approaches used to visualize peptidoglycan synthesis in V. cholerae LTG studies

Each method has specific strengths and limitations, and researchers often employ multiple approaches to corroborate findings.

How can crystallography be optimized for studying mtgA-substrate complexes?

Optimizing crystallography for mtgA-substrate complexes requires addressing several challenges specific to membrane-associated enzymes and their lipid substrates:

  • Protein preparation:

    • Expression strategies: Using fusion proteins (such as MBP or SUMO) to enhance solubility

    • Construct design: Creating truncated versions lacking highly flexible regions but retaining catalytic domains

    • Protein quality: Ensuring >95% purity and monodispersity by size-exclusion chromatography

    • Stabilization: Adding specific ligands or inhibitors to stabilize conformation

  • Substrate analog considerations:

    • Non-hydrolyzable analogs: Using substrate mimics resistant to enzymatic cleavage

    • Lipid modifications: Shortening lipid chains while maintaining key recognition elements

    • Solubility enhancement: Incorporating water-soluble groups to improve handling

  • Crystallization strategies:

    • Membrane protein-specific approaches: Lipidic cubic phase (LCP) crystallization

    • Detergent screening: Systematic testing of detergents and additives

    • Co-crystallization vs. soaking: Attempting both introducing substrate during crystallization and soaking pre-formed crystals

    • Seeding techniques: Using microseed matrix screening to improve crystal quality

  • Data collection optimization:

    • Synchrotron radiation: Using high-brilliance beamlines for small or weakly diffracting crystals

    • Multi-crystal data collection: Merging datasets from multiple crystals to improve completeness

    • Low-temperature data collection: Minimizing radiation damage through cryo-cooling protocols

The successful structural determination of S. aureus transglycosylase in complex with a lipid II analog at 2.3 Å resolution demonstrates the feasibility of this approach . This structure revealed key substrate-binding residues like K140 and R148 in the donor site, providing a template for similar studies with mtgA from Marinomonas sp.

What molecular dynamics approaches are suitable for studying mtgA conformational changes?

Molecular dynamics (MD) simulations offer powerful tools for investigating mtgA conformational changes and mechanistic details:

  • System preparation considerations:

    • Membrane embedding: Incorporating mtgA into a lipid bilayer that mimics bacterial membrane composition

    • Protonation states: Assigning appropriate protonation states to catalytic residues

    • Water and ion placement: Adding explicit solvent and physiological ion concentrations

    • Force field selection: Using specialized force fields optimized for protein-membrane systems

  • Simulation strategies:

    • Conventional MD: For exploring conformational dynamics near the native state (typically 100ns-1μs)

    • Enhanced sampling methods: Techniques like replica exchange or metadynamics to overcome energy barriers

    • Targeted MD: Guided simulations to explore substrate binding/unbinding pathways

    • Coarse-grained simulations: For studying larger-scale events over longer timescales

  • Specific simulation targets:

    • Substrate binding events: Characterizing the conformational changes upon lipid II binding

    • Catalytic mechanism: Investigating proton transfer and nucleophilic attack steps

    • Membrane interactions: Understanding how mtgA interfaces with the lipid bilayer

    • Protein-protein interactions: Exploring potential interactions with other cell wall synthesis enzymes

  • Analysis approaches:

    • Principal component analysis: Identifying major collective motions in the protein

    • Hydrogen bond/salt bridge analysis: Characterizing key stabilizing interactions

    • Free energy calculations: Quantifying binding energetics and reaction barriers

    • Dynamic network analysis: Identifying communication pathways within the protein

  • Integration with experimental data:

    • Validating simulations against crystal structures of homologous proteins

    • Using mutagenesis data to confirm the importance of residues identified in simulations

    • Designing new experiments based on computational predictions

These approaches have proven valuable for similar enzymes in understanding substrate recognition, catalytic mechanisms, and the effects of mutations on enzymatic function.

How can CRISPR-Cas9 be used to study mtgA function in vivo?

CRISPR-Cas9 technology offers powerful approaches to investigate mtgA function in bacterial systems:

  • Gene knockout/knockdown strategies:

    • Complete mtgA deletion to assess essentiality

    • CRISPRi (CRISPR interference) for tunable gene repression when complete knockout is lethal

    • Conditional knockouts to study gene function at specific growth phases

  • Gene editing approaches:

    • Point mutations to investigate specific residues identified in homologs (such as those equivalent to K140 and R148 in S. aureus)

    • Domain swaps with homologs to identify functional regions

    • Introduction of tags for protein visualization or purification

  • Combinatorial editing:

    • Creating multiple transglycosylase mutants to study functional redundancy, similar to the LTG studies in V. cholerae that revealed synthetic lethal relationships

    • Generating mutations in mtgA along with interacting partners

    • Synthetic genetic array approaches to identify genetic interactions

  • Regulatory element manipulation:

    • Promoter modifications to alter expression levels

    • Introduction of inducible systems for temporal control

    • UTR modifications to change translation efficiency

  • Experimental design considerations:

    • Guide RNA design to minimize off-target effects

    • Delivery methods appropriate to the bacterial species being studied

    • Control experiments with catalytically inactive Cas9 (dCas9)

    • Phenotypic characterization including growth, morphology, and antibiotic susceptibility

The V. cholerae studies demonstrate the power of genetic approaches in understanding transglycosylase function, revealing that multiple LTGs (including MltG/mtgA) exhibit complex functional relationships that may only be apparent under specific conditions or in multiple-knockout backgrounds .

What are the limitations of current assays for measuring mtgA activity?

Current assays for measuring transglycosylase activity face several important limitations that researchers should consider:

  • Substrate availability challenges:

    • Natural lipid II is difficult to isolate in sufficient quantities for extensive studies

    • Chemical synthesis is complex, expensive, and low-yielding

    • Substrate analogs may not fully recapitulate native activity

    • Commercial availability is limited and costly

  • Detection method limitations:

    • Many assays rely on indirect measurement of activity

    • Background hydrolysis can interfere with measurements

    • Signal-to-noise ratio can be problematic, especially for low-activity variants

    • Some methods require specialized equipment not available in all laboratories

  • In vitro vs. in vivo discrepancies:

    • In vitro conditions poorly mimic the crowded periplasmic environment

    • Detergents used for protein solubilization may alter enzyme behavior

    • Absence of interacting partners may affect activity

    • Activity measured in isolation may not reflect physiological function

  • Specific assay limitations:

    • Radioactive assays: Safety concerns and waste disposal issues

    • Fluorescence assays: Potential for inner filter effects and fluorophore interference

    • LC-MS methods: Expensive instrumentation and specialized expertise required

    • Coupled enzyme assays: Potential for false positives/negatives due to effects on coupling enzymes

  • Kinetic measurement challenges:

    • Difficulty maintaining initial rate conditions due to substrate limitations

    • Challenges in determining true Km and Vmax values

    • Processive nature of transglycosylases complicating kinetic analysis

    • Phase separation of lipid substrates causing concentration inconsistencies

These limitations highlight the importance of using multiple complementary approaches when studying mtgA activity, and carefully controlling for potential artifacts in any single assay system.

How does the activity of mtgA from Marinomonas sp. compare to homologs from pathogenic bacteria?

Comparative analysis of mtgA from Marinomonas sp. and homologs from pathogenic bacteria provides insights into evolutionary conservation and potential differences that might be exploited for therapeutic purposes:

This comparative understanding is valuable for developing broad-spectrum or species-specific inhibitors targeting transglycosylases as potential antibiotics.

What role does mtgA play in bacterial stress response and environmental adaptation?

Evidence from studies on related transglycosylases suggests mtgA likely plays important roles in bacterial stress response and environmental adaptation:

  • Osmotic stress response:

    • V. cholerae LTG mutants (including mltG mutants) showed hypersensitivity to hypo-osmotic conditions

    • This suggests a role for mtgA in maintaining cell wall integrity during osmotic fluctuations

    • The ∆7 LTG mutant (including mltG deletion) showed increased sensitivity that could not be rescued by the same mechanisms as the ∆6 LTG mutant

  • Antibiotic response:

    • LTG mutants in V. cholerae showed altered responses to β-lactam antibiotics, suggesting mtgA may influence antibiotic susceptibility

    • The role of mtgA in peptidoglycan synthesis makes it a key player in how bacteria respond to cell wall-targeting antibiotics

  • Growth phase adaptations:

    • The dilution-dependent growth defect observed in ∆7 LTG mutants suggests mtgA becomes particularly important during exponential growth

    • This indicates a role in adapting cell wall synthesis rates to different growth conditions

  • Environmental niche adaptation:

    • As a marine bacterium, Marinomonas sp. likely faces unique environmental challenges

    • The specific properties of its mtgA may reflect adaptations to marine conditions, including salinity fluctuations

    • Comparisons with mtgA from bacteria inhabiting different niches could reveal environment-specific adaptations

These roles highlight the importance of mtgA beyond basic cell wall synthesis and suggest its potential as a target for stress-potentiating antimicrobial strategies.

How does mtgA contribute to periplasmic homeostasis?

Studies of related transglycosylases provide important insights into how mtgA likely contributes to periplasmic homeostasis:

  • Prevention of periplasmic crowding:

    • Research on LTGs in V. cholerae demonstrated that these enzymes, including MltG (mtgA homolog), prevent toxic crowding of the periplasm with peptidoglycan polymers

    • Without sufficient LTG activity, soluble uncrosslinked peptidoglycan chains accumulate in the periplasm

    • This suggests mtgA plays a critical role in maintaining periplasmic space by processing peptidoglycan intermediates

  • Coordination with peptidoglycan recycling:

    • While recycling itself is not essential under standard conditions, proper processing of peptidoglycan fragments is important for periplasmic homeostasis

    • The processing of these fragments likely prevents interference with ongoing cell wall synthesis

  • Integration with other periplasmic processes:

    • LTG activity contributes to periplasmic processes upstream and independent of peptidoglycan recycling

    • This indicates mtgA may coordinate with other periplasmic functions beyond just cell wall synthesis

  • Evidence from spheroplast studies:

    • In V. cholerae, LTG mutants (including mltG mutants) showed accumulation of peptidoglycan material in the periplasm during spheroplast formation, visualized with the BADA fluorescent probe

    • This directly demonstrates the role of these enzymes in clearing peptidoglycan debris from the periplasm

  • Relationship to membrane processes:

    • As a membrane-anchored enzyme, mtgA likely helps coordinate membrane dynamics with cell wall synthesis

    • The release of newly synthesized peptidoglycan from the membrane is a critical step in maintaining both membrane and periplasmic homeostasis

These functions highlight the importance of mtgA in maintaining the periplasmic environment suitable for various cellular processes beyond just its direct role in cell wall synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.