Recombinant Marinomonas sp. Probable intracellular septation protein A (Mmwyl1_3397)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
yciB; Mmwyl1_3397; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Marinomonas sp. (strain MWYL1)
Target Names
Mmwyl1_3397
Target Protein Sequence
MKILFDFLPIVIFFVVYKMTGNIIIATAILIPATIIQVGFTWFKNRTIEKMHLVSLALVV LLGGATVLLGDGDFIKWKPTIVNGLFAIAFLGSQFIGDKNIIQRMMGDKLDLPFKVWRTL NLAWVGFFIVSGVTNLYVAFSYSEEIWVDFKLFGLLGMTIVFIILQGIYLSSHLQNKE
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Mmwyl1_3397 and what is its predicted function?

Mmwyl1_3397 is classified as a probable intracellular septation protein A in Marinomonas sp. strain MWYL1. Based on comparative analysis with homologous proteins like ispA in Shigella flexneri, this protein appears to play a critical role in bacterial cell division and septum formation . The protein consists of 178 amino acids and contains hydrophobic domains suggesting membrane association, which is consistent with its putative role in septation .

Methodology for functional prediction:

  • Sequence homology analysis with known septation proteins

  • Structural prediction based on hydrophobicity profiles

  • Comparative genomics across related bacterial species

How does Mmwyl1_3397 relate to septation proteins in other bacterial species?

Mmwyl1_3397 shares functional similarity with ispA in Shigella flexneri, which has been characterized as essential for proper cell division. In S. flexneri, mutation of ispA results in cells that initially spread intercellularly at normal rates but gradually slow down and cease spreading due to defects in cell division, leading to formation of long filamentous bacteria lacking septa .

Based on research with homologous proteins, septation proteins like Mmwyl1_3397 likely interact with other cell division machinery components, including:

  • FtsZ, which forms the Z-ring at midcell to initiate division

  • Nucleoid-associated proteins that prevent septum formation in regions occupied by chromosomes

  • Membrane-anchoring proteins essential for proper septum formation

Experimental approaches to study relationships:

  • Comparative genomics across marine bacterial species

  • Protein-protein interaction studies using pull-down assays

  • Complementation studies in related bacterial species

What methods can researchers use to express and purify recombinant Mmwyl1_3397?

Successfully expressing and purifying Mmwyl1_3397 requires strategies to address its highly hydrophobic nature:

Expression system optimization:

  • E. coli expression systems with appropriate tags (His-tag appears effective)

  • Consider membrane protein-specific expression systems like C41/C43 E. coli strains

  • Testing multiple fusion tags (MBP, SUMO, etc.) to improve solubility

Purification protocol:

  • Cell lysis in detergent-containing buffers (e.g., DDM, LDAO)

  • Metal chelate affinity chromatography under optimized conditions

  • Buffer optimization containing 50% glycerol and Tris-based buffer for stability

  • Storage at -20°C for short-term use or -80°C for extended storage

Storage considerations:

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Consider detergent screening to identify optimal stabilization conditions

How can researchers analyze the interaction between Mmwyl1_3397 and the bacterial nucleoid?

Analyzing how Mmwyl1_3397 interacts with the bacterial nucleoid requires specialized techniques:

Microscopy approaches:

  • Fluorescence microscopy with GFP/mCherry-tagged Mmwyl1_3397 to visualize localization relative to nucleoids

  • 3D Structured Illumination Microscopy (3D-SIM) to determine spatial distribution of Mmwyl1_3397 in relation to nucleoid during cell division

  • Electron microscopy to visualize ultra-structural details of septation

Biochemical approaches:

  • Chromatin immunoprecipitation (ChIP) to identify potential DNA binding

  • DNA gel shift assays to test direct DNA interaction capabilities

  • Co-immunoprecipitation to identify protein partners at the nucleoid-septum interface

Researchers studying similar proteins have found that nucleoid-associated proteins can influence nucleoid compaction and organization, which indirectly impacts septum formation .

What is the role of Mmwyl1_3397 in bacterial cell division and growth?

Based on studies of homologous proteins, Mmwyl1_3397 likely plays critical roles in:

  • Septum formation and integrity:

    • Facilitating proper invagination of cell membrane during division

    • Coordinating peptidoglycan synthesis at the division site

    • Ensuring complete separation of daughter cells

  • Cell morphology maintenance:

    • Preventing formation of filamentous cells

    • Ensuring proper cell size and shape after division

  • Coordination with other division systems:

    • Interaction with FtsZ-ring assembly

    • Coordination with nucleoid segregation mechanisms

    • Possible involvement in Min system function that prevents polar septation

Experimental approaches to assess these functions:

  • Gene deletion studies followed by phenotypic analysis

  • Complementation experiments with mutant variants

  • Time-lapse microscopy of dividing cells

  • Electron microscopy of septum formation

How might Mmwyl1_3397 function in microbial competition and survival?

While Mmwyl1_3397's primary role relates to cell division, it may indirectly impact competitive fitness:

  • Potential relationship to antimicrobial mechanisms:

    • Marinomonas species produce R-type bacteriocins with antimicrobial activity against related strains

    • Proper septation is essential for survival when competing with other marine bacteria

    • Cell division efficiency affects growth rates in competitive environments

  • Environmental adaptation:

    • Septation proteins may be involved in responses to environmental stressors

    • Cell morphology changes mediated by septation proteins can affect surface area-to-volume ratios

A study of Marinomonas mediterranea demonstrated that it produces R-type bacteriocins showing antimicrobial activity against other Marinomonas strains, which represents an additional mechanism in microbial competition . The table below shows antimicrobial susceptibility of various Marinomonas strains to bacteriocins:

Test StrainSusceptibility to Wild-TypeSusceptibility to ΔMEDPRO2
M. posidonicaRR
M. arcticaRR
M. vagaRR
M. communisRR
M. aquiplantarumSR
Marinomonas sp. MWYL1SR
M. mediterranea MMB-3RR

R = resistant, S = susceptible

What are the implications of Mmwyl1_3397 mutations for bacterial pathogenesis or environmental adaptation?

While Marinomonas sp. is not typically pathogenic, insights from homologous septation proteins in other bacteria reveal important implications:

  • Cell division defects impact infection processes:

    • In Shigella flexneri, ispA mutation causes defects in intercellular spreading within host cells

    • Septation mutants form long filamentous bacteria lacking septa, trapped within host cells

    • These mutants initially spread intercellularly at normal rates but gradually slow and stop spreading

  • Environmental adaptation mechanisms:

    • Proper septation is essential for growth rates and population dynamics

    • Septation proteins may influence bacterial responses to changing marine environments

    • Cell morphology changes can affect nutrient acquisition and stress responses

Research methodologies to investigate these implications:

  • Site-directed mutagenesis of conserved residues

  • Phenotypic analysis under various environmental conditions

  • Competitive growth assays with wild-type and mutant strains

  • Microscopic analysis of cell morphology and division patterns

How can CRISPR-Cas systems be used to study Mmwyl1_3397 function in Marinomonas species?

CRISPR-Cas technology offers powerful approaches for studying Mmwyl1_3397:

  • Gene editing strategies:

    • CRISPR-Cas9 for precise gene knockout

    • CRISPR interference (CRISPRi) for tunable gene repression

    • Base editing for introducing specific point mutations

  • Implementation considerations for Marinomonas:

    • Optimization of guide RNA design for marine bacteria

    • Selection of appropriate Cas variants for efficiency

    • Development of delivery methods for marine bacterial species

Marinomonas mediterranea has been studied as a model for CRISPR-Cas systems, with research revealing that strain MMB-1 harbors two distinct types of CRISPR-Cas systems (I-F and III-B subtypes) . This knowledge could be leveraged for developing genetic tools specific to Marinomonas species.

What techniques can researchers use to investigate protein-protein interactions involving Mmwyl1_3397?

Understanding Mmwyl1_3397's interaction network requires specialized techniques for membrane proteins:

  • In vivo interaction methods:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Proximity-dependent biotin labeling (BioID)

    • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

  • In vitro interaction analysis:

    • Co-immunoprecipitation with detergent-solubilized membranes

    • Surface plasmon resonance with purified components

    • Chemical cross-linking followed by mass spectrometry

  • Computational prediction:

    • Protein-protein interaction database mining

    • Co-evolution analysis to identify potential binding partners

    • Structural modeling of interaction interfaces

These approaches would help establish the protein interaction network of Mmwyl1_3397, providing insights into its functional mechanisms during bacterial cell division.

How can structural biology approaches advance our understanding of Mmwyl1_3397?

Despite challenges in working with membrane proteins, several structural biology approaches could be applied:

  • Advanced structural determination methods:

    • X-ray crystallography with lipidic cubic phase crystallization

    • Cryo-electron microscopy for membrane protein complexes

    • NMR spectroscopy for dynamic regions and smaller fragments

  • Computational structure prediction:

    • AlphaFold or RoseTTAFold for full protein modeling

    • Molecular dynamics simulations in membrane environments

    • Homology modeling based on related septation proteins

  • Structure-function analysis:

    • Identification of conserved functional domains

    • Site-directed mutagenesis guided by structural insights

    • Structure-based design of inhibitors or activity modulators

A thorough structural understanding would provide critical insights into how Mmwyl1_3397 functions at the molecular level during bacterial cell division.

What are the key challenges in working with Mmwyl1_3397 and how can researchers overcome them?

Researchers face several challenges when studying Mmwyl1_3397:

  • Expression and purification difficulties:

    • Highly hydrophobic nature complicates standard expression protocols

    • Membrane protein purification requires specialized detergents

    • Potential toxicity when overexpressed

  • Functional assay limitations:

    • Difficulty in reconstituting septation processes in vitro

    • Complex interactions with multiple division proteins

    • Limited tools for genetic manipulation in Marinomonas sp.

  • Practical solutions:

    • Use specialized expression strains for membrane proteins

    • Optimize detergent screening for purification

    • Consider heterologous expression in model organisms

    • Develop Marinomonas-specific genetic tools

    • Collaborate with experts in bacterial cell division

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.