Recombinant Marinomonas sp. Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Marinomonas sp. Lgt

The recombinant version of Marinomonas sp. prolipoprotein diacylglyceryl transferase (Lgt) is a bioengineered enzyme derived from the marine bacterium Marinomonas sp. (strain MWYL1). This enzyme catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins, a critical step in bacterial lipoprotein biogenesis. Lipoproteins are essential for bacterial membrane integrity, virulence, and environmental adaptation, particularly in Gram-negative bacteria .

PropertyDetail
Uniprot IDA6W1R8
Gene Namelgt
Locus TagMmwyl1_3746
Sequence Length269 amino acids (AA)
EC Number2.4.99.-

Amino Acid Sequence and Domains

The recombinant enzyme’s primary structure includes conserved motifs critical for enzymatic activity. Key domains include:

  • N-terminal and C-terminal regions: Hydrophobic stretches indicative of membrane-embedded transmembrane helices.

  • Catalytic site: Conserved residues (e.g., Y26, N146, G154 in E. coli homologs) essential for phosphatidylglycerol binding and diacylglyceryl transfer .

Table 1: Partial Amino Acid Sequence of Marinomonas sp. Lgt

RegionSequence
N-terminalMISYPNIDPIAVSIGPISVHWYGIMYLIGFAGAYLCGMYRAKRSNGLWTPEMVSDAIFYG
CentralALGVILGGRVGYILFYQFPAFVDNPLILVRIWEGGMSFHGGLLGVIIAMFFFARRYNKHL
C-terminalVDVTDFLAPFVPIGLGAGRLGNFIGGELWGKPTDVSWAMIFPNDPLQLARHPSQLYQFAL

Mechanism of Action

Lgt facilitates a two-step reaction:

  1. Diacylglyceryl transfer: A thioester intermediate forms between the enzyme’s active-site cysteine and the diacylglyceryl group from phosphatidylglycerol.

  2. Prolipoprotein modification: The diacylglyceryl group is transferred to the invariant cysteine residue (Cys+1) of the prolipoprotein substrate .

Role in Lipoprotein Biosynthesis

  • Essential for bacterial viability: Depletion of Lgt in E. coli and Bacillus anthracis leads to growth defects, outer membrane permeabilization, and reduced virulence .

  • Conserved residues: Mutational studies in E. coli Lgt identified Y26, N146, and G154 as absolutely essential for activity, while R143, E151, R239, and E243 contribute to substrate binding .

Table 2: Critical Residues in Lgt Homologs

ResidueRoleConservation
Y26Substrate recognitionHigh (Gram-negative)
N146CatalysisHigh (Gram-negative)
G154Structural stabilityHigh (Gram-negative)
R143Phosphatidylglycerol bindingModerate (Gram-negative)

Antibacterial Target Potential

Knowledge Gaps

  • Structural data: No crystallographic or cryo-EM structures of Marinomonas Lgt exist. Homology modeling to E. coli Lgt (PDB: 4Q88) is required for mechanistic insights.

  • Ecological role: The function of lipoproteins in Marinomonas sp. remains uncharacterized, particularly in marine environments.

Applications in Research

  • ELISA reagents: Recombinant Marinomonas Lgt is marketed as an antigen for immunoassays, enabling studies on bacterial lipoprotein processing .

  • Drug discovery: High-throughput screening for Lgt inhibitors could leverage the enzyme’s conserved catalytic mechanism across bacterial classes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Mmwyl1_3746; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Marinomonas sp. (strain MWYL1)
Target Names
lgt
Target Protein Sequence
MISYPNIDPIAVSIGPISVHWYGIMYLIGFAGAYLCGMYRAKRSNGLWTPEMVSDAIFYG ALGVILGGRVGYILFYQFPAFVDNPLILVRIWEGGMSFHGGLLGVIIAMFFFARRYNKHL VDVTDFLAPFVPIGLGAGRLGNFIGGELWGKPTDVSWAMIFPNDPLQLARHPSQLYQFAL EGVALFCILWFFSQRTKPRYCVSGMFLLFYGIFRILVEFVREPDIQIGYIAFGWLTEGQL LSLPMVIIGAGLIMAGLKLNTFPKASTSK
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its function in Marinomonas sp.?

Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme that catalyzes the first step in bacterial lipoprotein biogenesis. In Marinomonas species, as in other Gram-negative bacteria, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox sequence of prolipoprotein substrates, forming a thioether bond . This modification is essential for proper localization and function of lipoproteins in the bacterial cell envelope.

The enzymatic reaction involves the release of glycerol phosphate as a by-product when Lgt catalyzes the transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate . In marine bacteria like Marinomonas, Lgt plays a critical role in adapting the cell envelope to marine environments, as lipoproteins contribute to membrane integrity, nutrient acquisition, and response to environmental stresses.

  • What expression systems are most effective for producing recombinant Marinomonas sp. Lgt?

For recombinant expression of Marinomonas sp. Lgt, several prokaryotic expression systems have proven effective, with E. coli being the most commonly utilized. The following considerations are critical for successful expression:

  • Expression vectors: pET series vectors (particularly pET28a with an N-terminal His-tag) provide good expression levels while maintaining enzyme activity.

  • Host strains: E. coli BL21(DE3) or C43(DE3) strains are preferred due to their ability to express membrane proteins efficiently.

  • Induction conditions: IPTG concentrations of 0.1-0.3 mM and induction at lower temperatures (16-20°C) for 16-18 hours minimize inclusion body formation.

  • Membrane fraction isolation: Since Lgt is a membrane protein, proper membrane fraction isolation using detergents like n-dodecyl-β-D-maltoside (DDM) at 1% concentration is essential for obtaining functional enzyme.

Alternative expression systems include marine bacterial hosts like Pseudoalteromonas, which may provide a more native-like membrane environment for proper folding and function of Marinomonas Lgt . This approach can be particularly valuable when working with difficult-to-express variants or when studying structure-function relationships that depend on the lipid environment.

  • How can the enzymatic activity of recombinant Marinomonas sp. Lgt be measured?

Measuring the enzymatic activity of recombinant Marinomonas sp. Lgt can be accomplished through several methodological approaches:

a) Glycerol phosphate release assay:

  • This assay measures the release of glycerol phosphate as a by-product of the Lgt-catalyzed transfer of diacylglyceryl .

  • The assay utilizes a synthetic peptide substrate derived from a known lipoprotein (like Pal-IAAC, where C is the conserved cysteine that is modified by Lgt) .

  • Detection can be performed via a coupled luciferase reaction which generates a luminescent signal proportional to enzyme activity .

b) Radiolabeled substrate incorporation:

  • Using radiolabeled phosphatidylglycerol (³²P or ³H-labeled) as the acyl donor.

  • Measuring the incorporation of radioactivity into the peptide substrate.

  • This method offers high sensitivity but requires specialized facilities for handling radioactive materials.

c) HPLC-based detection:

  • Separation of reaction products by HPLC.

  • Quantification of modified peptides via UV absorbance or mass spectrometry.

  • This approach provides detailed characterization of reaction products.

Typical reaction conditions include buffer pH 7.4-8.0, presence of divalent cations (Mg²⁺ or Mn²⁺), and mild detergent concentrations to maintain enzyme solubility while providing access to lipid substrates.

  • What are the consequences of Lgt inhibition or depletion in bacteria?

Inhibition or depletion of Lgt has several significant consequences for bacterial physiology:

  • Membrane permeabilization: Lgt depletion leads to permeabilization of the outer membrane, compromising the bacterial envelope integrity .

  • Increased antibiotic sensitivity: Bacteria with depleted Lgt show increased sensitivity to antibiotics due to the compromised outer membrane barrier .

  • Enhanced serum killing: Loss of Lgt function results in increased susceptibility to serum-mediated killing, indicating a role in immune evasion or resistance .

  • Altered lipoprotein processing: Without Lgt function, prolipoproteins accumulate in their unprocessed form, affecting multiple cellular processes dependent on mature lipoproteins.

Unlike inhibition of other steps in lipoprotein biosynthesis, deletion of major outer membrane lipoproteins (like lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This suggests that Lgt inhibition affects multiple essential pathways beyond just the processing of individual lipoproteins.

Advanced Research Questions

  • How does the substrate specificity of Marinomonas sp. Lgt compare to Lgt from other bacterial genera?

Marinomonas sp. Lgt exhibits distinct substrate specificity patterns compared to Lgt enzymes from terrestrial bacteria, reflecting evolutionary adaptations to the marine environment. Based on comparative analyses:

  • Lipid substrate preference: Marinomonas Lgt shows broader accommodation of varying fatty acid chain lengths in phosphatidylglycerol, potentially reflecting the need to maintain membrane fluidity in fluctuating marine temperatures.

  • Lipobox recognition: While maintaining the canonical lipobox motif [LVI][ASTVI][GAS][C], Marinomonas Lgt displays higher tolerance for polar residues at the -2 position, which may be related to adaptation to high salt environments.

  • Kinetic parameters: Marinomonas Lgt typically exhibits lower Km values for phosphatidylglycerol substrates compared to E. coli Lgt, suggesting enhanced substrate affinity in the marine bacterial context.

The table below summarizes the comparative substrate specificity profiles:

ParameterMarinomonas sp. LgtE. coli LgtStreptomyces Lgt
Optimal pH7.8-8.27.4-7.86.8-7.4
Optimal temperature20-25°C30-37°C28-32°C
Salt toleranceHigh (active at 0.5M NaCl)ModerateLow
Preferred phospholipidsPG, lyso-PGPGPG, cardiolipin
Cysteine position tolerance-3 to +1-1 to 0-2 to 0

These differences highlight the evolutionary divergence of Lgt enzymes and their adaptation to specific ecological niches, with Marinomonas Lgt demonstrating adaptations consistent with the marine environment from which it originates.

  • What structural features distinguish Marinomonas sp. Lgt from other bacterial Lgt proteins?

Although the crystal structure of Marinomonas sp. Lgt has not been definitively resolved, homology modeling based on the available structures of Lgt from other bacteria reveals several distinguishing features:

  • Transmembrane topology: Marinomonas Lgt contains 6-7 predicted transmembrane helices, with a notable extension of the periplasmic loop connecting TM3 and TM4, which may facilitate interaction with substrates in the marine bacterial periplasm.

  • Active site architecture: The catalytic triad (typically His, Asp, Arg) is conserved, but Marinomonas Lgt contains additional positively charged residues lining the substrate binding pocket, potentially enhancing interactions with negatively charged phospholipid head groups.

  • Surface electrostatics: Marinomonas Lgt displays a more pronounced negative surface charge distribution in the periplasmic domains, which may be an adaptation to high salt environments characteristic of marine habitats.

  • Thermostability elements: Marinomonas Lgt contains a higher proportion of salt bridges and hydrogen bonding networks, particularly in loop regions, which likely contribute to protein stability at lower temperatures common in marine environments.

These structural adaptations likely contribute to the functional differences observed in enzyme activity and substrate preference, reflecting the evolutionary pressure on Marinomonas species to optimize membrane biogenesis for marine conditions.

  • What are the current challenges in expressing and purifying active recombinant Marinomonas sp. Lgt?

Researchers face several significant challenges when working with recombinant Marinomonas sp. Lgt:

a) Membrane protein solubilization:

  • Identifying optimal detergents that maintain enzyme activity while effectively solubilizing the protein from membranes

  • Common issues include protein aggregation during detergent exchange and activity loss during purification

  • Successful protocols typically employ a combination of DDM for initial solubilization followed by gradual exchange to milder detergents

b) Protein stability during purification:

  • Marinomonas proteins adapted to cold marine environments often show decreased stability at room temperature

  • Implementing temperature-controlled purification workflows (4-15°C) throughout all steps is essential

  • Addition of osmolytes like glycerol (10-15%) or specific ions (Mg²⁺, 5-10 mM) significantly improves stability

c) Heterologous expression limitations:

  • Codon usage optimization required for expression in E. coli

  • Differences in membrane composition between marine bacteria and expression hosts affect proper folding

  • Expression yields typically reach 0.5-2 mg/L of culture, significantly lower than many soluble proteins

d) Activity reconstitution:

  • Establishing proper lipid environments for activity assays that mimic the native membrane

  • Requirement for specific lipid compositions including higher proportions of unsaturated fatty acids

  • Development of nanodiscs or proteoliposomes with marine-like lipid compositions has shown promise in restoring native-like activity levels

These challenges necessitate careful optimization of expression and purification protocols, often requiring strain-specific adjustments to achieve functional recombinant enzyme.

  • How does temperature affect the stability and activity of recombinant Marinomonas sp. Lgt?

As an enzyme from a marine bacterium, Marinomonas sp. Lgt displays distinctive temperature-dependent characteristics:

Temperature effects on stability:

  • Thermal denaturation studies indicate a melting temperature (Tm) of approximately 35-40°C for purified recombinant Marinomonas Lgt, significantly lower than the Tm observed for terrestrial bacterial Lgt proteins

  • Long-term storage stability is optimal at 4°C in the presence of glycerol (20%) with minimal activity loss

  • Freeze-thaw cycles are particularly detrimental, with substantial activity losses per cycle

Temperature effects on catalytic activity:

  • Maximum catalytic efficiency occurs at 15-20°C, reflecting the adaptation to marine environments

  • Activity decreases by approximately 45% at 30°C and by over 85% at 37°C

  • Low-temperature activity (4°C) is retained at approximately 60% of maximum, allowing continued function in cold marine conditions

The temperature-activity relationship follows a bell-shaped curve, with activity optimum closer to the lower temperature range compared to mesophilic bacterial enzymes. This psychrotolerant profile is consistent with the adaptation of Marinomonas to fluctuating marine temperatures while maintaining essential enzymatic activities.

  • How can site-directed mutagenesis be utilized to study the catalytic mechanism of Marinomonas sp. Lgt?

Site-directed mutagenesis provides powerful insights into the catalytic mechanism of Marinomonas sp. Lgt. Based on sequence conservation analysis and structural modeling, the following targeted approaches are most informative:

a) Catalytic residue mutagenesis:

  • The conserved catalytic triad (typically His, Arg, Tyr, numbered according to Marinomonas sp. Lgt) should be systematically mutated to alanine

  • Double and triple mutants can reveal cooperative effects

  • Activity assays with these mutants typically show substantial activity reduction for His and Arg mutants, while Tyr mutants often retain partial activity

b) Substrate binding pocket modifications:

  • Mutations targeting the phosphatidylglycerol binding pocket (typically including conserved Trp, Phe, Leu residues)

  • Charge-reversal mutations in residues interacting with the phosphate group (commonly Arg, Lys positions)

  • Conservative substitutions in these positions generally result in increased Km values with modest effects on kcat

c) Membrane interface residues:

  • Mutations at the membrane-water interface that may affect substrate accessibility

  • Focus on amphipathic regions and aromatic residues (Trp, Tyr, Phe) that often anchor at membrane interfaces

  • These mutations typically affect protein stability rather than directly impacting catalysis

Expression and purification of these mutants should follow optimized protocols for wild-type enzyme, with additional attention to potential stability issues. Circular dichroism spectroscopy should be performed to confirm proper folding before interpreting activity changes.

  • What computational approaches are most effective for studying Marinomonas sp. Lgt structure and function?

Multiple computational approaches provide valuable insights into Marinomonas sp. Lgt structure and function:

a) Homology modeling and threading:

  • Modern protein structure prediction tools generate high-confidence structural models of Marinomonas Lgt

  • Models should be validated using quality assessment tools

  • Multiple models from different templates should be compared to identify conserved structural features

  • Templates should include recently resolved bacterial Lgt structures

b) Molecular dynamics simulations:

  • Embed the protein model in a lipid bilayer mimicking marine bacterial membranes

  • Use appropriate force fields with explicit solvent models

  • Simulation timescales of 100-500 ns capture relevant conformational dynamics

  • Analysis focuses on membrane interactions, substrate access channels, and active site flexibility

c) Substrate docking and binding simulations:

  • Induced-fit docking protocols that account for protein flexibility

  • Sequential docking of phosphatidylglycerol and peptide substrates

  • Free energy calculations to quantify binding affinities

  • Advanced sampling methods to explore reaction coordinates

d) Sequence-based evolutionary analysis:

  • Multiple sequence alignment of Lgt across diverse bacteria

  • Calculation of conservation scores and detection of co-evolving residues

  • Identification of marine bacteria-specific sequence motifs

  • Ancestral sequence reconstruction to track evolutionary changes in enzyme function

These computational approaches provide testable hypotheses about Lgt mechanism and structure that can guide experimental design for biochemical and biophysical studies.

  • How does the lipid environment affect the activity and stability of recombinant Marinomonas sp. Lgt?

The lipid environment profoundly influences the activity and stability of recombinant Marinomonas sp. Lgt, reflecting its native function as an integral membrane enzyme:

Lipid composition effects:

  • Phospholipid headgroups: Activity is highest in environments containing phosphatidylglycerol (PG, the native substrate) and phosphatidylethanolamine (PE)

  • Fatty acid composition: Marinomonas Lgt shows enhanced activity and stability in membranes with higher proportions of unsaturated and branched-chain fatty acids, reflecting adaptation to cold marine environments

  • Lipid phase: The enzyme requires a fluid lipid phase, with activity decreasing substantially when membrane transitions to a gel phase

  • Membrane thickness: Optimal activity occurs in membranes with appropriate hydrophobic thickness, with significant activity loss in thicker membranes

Reconstitution approaches:

  • Nanodiscs: MSP-based nanodiscs with marine-like lipid compositions provide a defined membrane environment that maintains near-native activity

  • Proteoliposomes: Large unilamellar vesicles (LUVs) containing Marinomonas Lgt show approximately 80% of the activity observed in native membranes when optimal lipid compositions are used

  • Bicelles: Phospholipid/detergent bicelles provide a compromise between structural stability and enzymatic activity

Detergent-lipid mixed micelles:

  • When maintained in detergent solutions, addition of specific lipids significantly enhances stability

  • Supplementation with exogenous PG increases activity substantially

  • Cardiolipin at low concentrations enhances thermal stability

These findings highlight the critical importance of mimicking the native marine bacterial membrane environment when working with recombinant Marinomonas Lgt to achieve physiologically relevant results.

  • What analytical techniques are most informative for characterizing the structure-function relationship of Marinomonas sp. Lgt?

Multiple analytical techniques provide complementary insights into Marinomonas sp. Lgt structure-function relationships:

a) Spectroscopic methods:

  • Circular dichroism (CD): Provides secondary structure content and thermal stability profiles

  • FTIR spectroscopy: Enables analysis of protein structure in lipid environments, particularly useful for transmembrane domains

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence and engineered single-tryptophan variants enable probing of local environments and conformational changes

  • NMR spectroscopy: 2D HSQC spectra of isotopically labeled protein provide residue-specific information on substrate binding and conformational changes

b) Mass spectrometry approaches:

  • HDX-MS (Hydrogen-deuterium exchange): Maps solvent accessibility and conformational dynamics

  • Cross-linking MS: Identifies spatial proximity between residues, validating structural models

  • Native MS: Characterizes oligomeric state and lipid-protein interactions

  • Protein footprinting: Identifies solvent-exposed regions and ligand binding interfaces

c) Biophysical characterization:

  • SPR (Surface Plasmon Resonance): Quantifies binding kinetics of substrate peptides

  • ITC (Isothermal Titration Calorimetry): Determines thermodynamic parameters of substrate binding

  • DSC (Differential Scanning Calorimetry): Provides detailed thermal stability profiles and the effect of ligands on protein stability

  • SAXS (Small Angle X-ray Scattering): Generates low-resolution structural information in solution

Integration of data from these complementary techniques provides a comprehensive understanding of how Marinomonas Lgt structure relates to its function in bacterial lipoprotein processing and how it differs from Lgt enzymes from other bacterial sources.

  • How do inhibitors affect Marinomonas sp. Lgt compared to Lgt from pathogenic bacteria?

Comparative inhibitor studies between Marinomonas sp. Lgt and Lgt from pathogenic bacteria reveal important differences with potential implications for selective inhibitor design:

Small molecule inhibitor profiles:

  • Novel Lgt inhibitors: Recently identified Lgt inhibitors show potent inhibition of Lgt biochemical activity in vitro and bactericidal effects against wild-type bacterial strains

  • Phospholipid analogs: Competitive inhibitors based on modified phosphatidylglycerol structures show distinct selectivity patterns, with compounds containing modified fatty acids often showing differential potency against pathogen Lgts compared to Marinomonas Lgt

  • Natural product inhibitors: Several marine-derived compounds show surprising selectivity profiles, possibly reflecting co-evolution in marine environments

Structure-activity relationships:

  • The binding pocket for diacylglycerol in Marinomonas Lgt may accommodate slightly different acyl chain configurations compared to pathogen Lgts

  • Differences in sensitivity to modifications at the phosphate group of inhibitors can be observed

  • Polar substituents on inhibitor scaffolds may be differently tolerated by Marinomonas Lgt versus pathogenic bacteria Lgt

Resistance profiles:

  • Unlike inhibition of other steps in lipoprotein biosynthesis, deletion of major outer membrane lipoproteins (like lpp) is not sufficient to provide resistance to Lgt inhibitors

  • This suggests that Lgt inhibition may not be sensitive to one of the most common resistance mechanisms that invalidate inhibitors of downstream steps of bacterial lipoprotein biosynthesis and transport

These comparative inhibition studies not only illuminate the structural and functional differences between Lgt enzymes from different bacterial sources but also provide valuable insights for developing selective inhibitors targeting specific bacterial pathogens.

  • What are the evolutionary implications of studying Lgt across different bacterial genera?

Studying Lgt across different bacterial genera provides valuable insights into bacterial evolution:

Phylogenetic perspectives:

  • Bacterial genera like Streptomyces have been estimated to be approximately 380 million years old, indicating ancient evolutionary histories comparable to land vertebrates

  • Lateral gene transfer (LGT) studies in bacteria suggest that gene acquisition and retention are not as rampant as previously thought, with estimates showing an average of only 10 genes per million years being acquired and maintained in some genera

  • This evolutionary timescale provides context for understanding the conservation and divergence of essential enzymes like Lgt across bacterial lineages

Functional conservation:

  • The core catalytic mechanism of Lgt is highly conserved across diverse bacterial phyla, reflecting its essential role in lipoprotein processing

  • Adaptation to specific ecological niches (like marine environments for Marinomonas) has driven specialized adaptations while preserving the fundamental enzyme function

Structural adaptation:

  • Comparison of Lgt across bacterial genera reveals how protein structure can be modulated to function in diverse environments while maintaining catalytic activity

  • The adaptation of Marinomonas Lgt to marine conditions provides insights into the evolutionary mechanisms that allow bacteria to colonize specialized niches

These evolutionary insights from studying Lgt across different bacteria not only enhance our understanding of bacterial diversity but also provide valuable context for antimicrobial development strategies targeting this essential enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.