The recombinant version of Marinomonas sp. prolipoprotein diacylglyceryl transferase (Lgt) is a bioengineered enzyme derived from the marine bacterium Marinomonas sp. (strain MWYL1). This enzyme catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins, a critical step in bacterial lipoprotein biogenesis. Lipoproteins are essential for bacterial membrane integrity, virulence, and environmental adaptation, particularly in Gram-negative bacteria .
| Property | Detail |
|---|---|
| Uniprot ID | A6W1R8 |
| Gene Name | lgt |
| Locus Tag | Mmwyl1_3746 |
| Sequence Length | 269 amino acids (AA) |
| EC Number | 2.4.99.- |
The recombinant enzyme’s primary structure includes conserved motifs critical for enzymatic activity. Key domains include:
N-terminal and C-terminal regions: Hydrophobic stretches indicative of membrane-embedded transmembrane helices.
Catalytic site: Conserved residues (e.g., Y26, N146, G154 in E. coli homologs) essential for phosphatidylglycerol binding and diacylglyceryl transfer .
| Region | Sequence |
|---|---|
| N-terminal | MISYPNIDPIAVSIGPISVHWYGIMYLIGFAGAYLCGMYRAKRSNGLWTPEMVSDAIFYG |
| Central | ALGVILGGRVGYILFYQFPAFVDNPLILVRIWEGGMSFHGGLLGVIIAMFFFARRYNKHL |
| C-terminal | VDVTDFLAPFVPIGLGAGRLGNFIGGELWGKPTDVSWAMIFPNDPLQLARHPSQLYQFAL |
Lgt facilitates a two-step reaction:
Diacylglyceryl transfer: A thioester intermediate forms between the enzyme’s active-site cysteine and the diacylglyceryl group from phosphatidylglycerol.
Prolipoprotein modification: The diacylglyceryl group is transferred to the invariant cysteine residue (Cys+1) of the prolipoprotein substrate .
Essential for bacterial viability: Depletion of Lgt in E. coli and Bacillus anthracis leads to growth defects, outer membrane permeabilization, and reduced virulence .
Conserved residues: Mutational studies in E. coli Lgt identified Y26, N146, and G154 as absolutely essential for activity, while R143, E151, R239, and E243 contribute to substrate binding .
| Residue | Role | Conservation |
|---|---|---|
| Y26 | Substrate recognition | High (Gram-negative) |
| N146 | Catalysis | High (Gram-negative) |
| G154 | Structural stability | High (Gram-negative) |
| R143 | Phosphatidylglycerol binding | Moderate (Gram-negative) |
Structural data: No crystallographic or cryo-EM structures of Marinomonas Lgt exist. Homology modeling to E. coli Lgt (PDB: 4Q88) is required for mechanistic insights.
Ecological role: The function of lipoproteins in Marinomonas sp. remains uncharacterized, particularly in marine environments.
KEGG: mmw:Mmwyl1_3746
STRING: 400668.Mmwyl1_3746
What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its function in Marinomonas sp.?
Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme that catalyzes the first step in bacterial lipoprotein biogenesis. In Marinomonas species, as in other Gram-negative bacteria, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox sequence of prolipoprotein substrates, forming a thioether bond . This modification is essential for proper localization and function of lipoproteins in the bacterial cell envelope.
The enzymatic reaction involves the release of glycerol phosphate as a by-product when Lgt catalyzes the transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate . In marine bacteria like Marinomonas, Lgt plays a critical role in adapting the cell envelope to marine environments, as lipoproteins contribute to membrane integrity, nutrient acquisition, and response to environmental stresses.
What expression systems are most effective for producing recombinant Marinomonas sp. Lgt?
For recombinant expression of Marinomonas sp. Lgt, several prokaryotic expression systems have proven effective, with E. coli being the most commonly utilized. The following considerations are critical for successful expression:
Expression vectors: pET series vectors (particularly pET28a with an N-terminal His-tag) provide good expression levels while maintaining enzyme activity.
Host strains: E. coli BL21(DE3) or C43(DE3) strains are preferred due to their ability to express membrane proteins efficiently.
Induction conditions: IPTG concentrations of 0.1-0.3 mM and induction at lower temperatures (16-20°C) for 16-18 hours minimize inclusion body formation.
Membrane fraction isolation: Since Lgt is a membrane protein, proper membrane fraction isolation using detergents like n-dodecyl-β-D-maltoside (DDM) at 1% concentration is essential for obtaining functional enzyme.
Alternative expression systems include marine bacterial hosts like Pseudoalteromonas, which may provide a more native-like membrane environment for proper folding and function of Marinomonas Lgt . This approach can be particularly valuable when working with difficult-to-express variants or when studying structure-function relationships that depend on the lipid environment.
How can the enzymatic activity of recombinant Marinomonas sp. Lgt be measured?
Measuring the enzymatic activity of recombinant Marinomonas sp. Lgt can be accomplished through several methodological approaches:
a) Glycerol phosphate release assay:
This assay measures the release of glycerol phosphate as a by-product of the Lgt-catalyzed transfer of diacylglyceryl .
The assay utilizes a synthetic peptide substrate derived from a known lipoprotein (like Pal-IAAC, where C is the conserved cysteine that is modified by Lgt) .
Detection can be performed via a coupled luciferase reaction which generates a luminescent signal proportional to enzyme activity .
b) Radiolabeled substrate incorporation:
Using radiolabeled phosphatidylglycerol (³²P or ³H-labeled) as the acyl donor.
Measuring the incorporation of radioactivity into the peptide substrate.
This method offers high sensitivity but requires specialized facilities for handling radioactive materials.
c) HPLC-based detection:
Separation of reaction products by HPLC.
Quantification of modified peptides via UV absorbance or mass spectrometry.
This approach provides detailed characterization of reaction products.
Typical reaction conditions include buffer pH 7.4-8.0, presence of divalent cations (Mg²⁺ or Mn²⁺), and mild detergent concentrations to maintain enzyme solubility while providing access to lipid substrates.
What are the consequences of Lgt inhibition or depletion in bacteria?
Inhibition or depletion of Lgt has several significant consequences for bacterial physiology:
Membrane permeabilization: Lgt depletion leads to permeabilization of the outer membrane, compromising the bacterial envelope integrity .
Increased antibiotic sensitivity: Bacteria with depleted Lgt show increased sensitivity to antibiotics due to the compromised outer membrane barrier .
Enhanced serum killing: Loss of Lgt function results in increased susceptibility to serum-mediated killing, indicating a role in immune evasion or resistance .
Altered lipoprotein processing: Without Lgt function, prolipoproteins accumulate in their unprocessed form, affecting multiple cellular processes dependent on mature lipoproteins.
Unlike inhibition of other steps in lipoprotein biosynthesis, deletion of major outer membrane lipoproteins (like lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This suggests that Lgt inhibition affects multiple essential pathways beyond just the processing of individual lipoproteins.
How does the substrate specificity of Marinomonas sp. Lgt compare to Lgt from other bacterial genera?
Marinomonas sp. Lgt exhibits distinct substrate specificity patterns compared to Lgt enzymes from terrestrial bacteria, reflecting evolutionary adaptations to the marine environment. Based on comparative analyses:
Lipid substrate preference: Marinomonas Lgt shows broader accommodation of varying fatty acid chain lengths in phosphatidylglycerol, potentially reflecting the need to maintain membrane fluidity in fluctuating marine temperatures.
Lipobox recognition: While maintaining the canonical lipobox motif [LVI][ASTVI][GAS][C], Marinomonas Lgt displays higher tolerance for polar residues at the -2 position, which may be related to adaptation to high salt environments.
Kinetic parameters: Marinomonas Lgt typically exhibits lower Km values for phosphatidylglycerol substrates compared to E. coli Lgt, suggesting enhanced substrate affinity in the marine bacterial context.
The table below summarizes the comparative substrate specificity profiles:
| Parameter | Marinomonas sp. Lgt | E. coli Lgt | Streptomyces Lgt |
|---|---|---|---|
| Optimal pH | 7.8-8.2 | 7.4-7.8 | 6.8-7.4 |
| Optimal temperature | 20-25°C | 30-37°C | 28-32°C |
| Salt tolerance | High (active at 0.5M NaCl) | Moderate | Low |
| Preferred phospholipids | PG, lyso-PG | PG | PG, cardiolipin |
| Cysteine position tolerance | -3 to +1 | -1 to 0 | -2 to 0 |
These differences highlight the evolutionary divergence of Lgt enzymes and their adaptation to specific ecological niches, with Marinomonas Lgt demonstrating adaptations consistent with the marine environment from which it originates.
What structural features distinguish Marinomonas sp. Lgt from other bacterial Lgt proteins?
Although the crystal structure of Marinomonas sp. Lgt has not been definitively resolved, homology modeling based on the available structures of Lgt from other bacteria reveals several distinguishing features:
Transmembrane topology: Marinomonas Lgt contains 6-7 predicted transmembrane helices, with a notable extension of the periplasmic loop connecting TM3 and TM4, which may facilitate interaction with substrates in the marine bacterial periplasm.
Active site architecture: The catalytic triad (typically His, Asp, Arg) is conserved, but Marinomonas Lgt contains additional positively charged residues lining the substrate binding pocket, potentially enhancing interactions with negatively charged phospholipid head groups.
Surface electrostatics: Marinomonas Lgt displays a more pronounced negative surface charge distribution in the periplasmic domains, which may be an adaptation to high salt environments characteristic of marine habitats.
Thermostability elements: Marinomonas Lgt contains a higher proportion of salt bridges and hydrogen bonding networks, particularly in loop regions, which likely contribute to protein stability at lower temperatures common in marine environments.
These structural adaptations likely contribute to the functional differences observed in enzyme activity and substrate preference, reflecting the evolutionary pressure on Marinomonas species to optimize membrane biogenesis for marine conditions.
What are the current challenges in expressing and purifying active recombinant Marinomonas sp. Lgt?
Researchers face several significant challenges when working with recombinant Marinomonas sp. Lgt:
a) Membrane protein solubilization:
Identifying optimal detergents that maintain enzyme activity while effectively solubilizing the protein from membranes
Common issues include protein aggregation during detergent exchange and activity loss during purification
Successful protocols typically employ a combination of DDM for initial solubilization followed by gradual exchange to milder detergents
b) Protein stability during purification:
Marinomonas proteins adapted to cold marine environments often show decreased stability at room temperature
Implementing temperature-controlled purification workflows (4-15°C) throughout all steps is essential
Addition of osmolytes like glycerol (10-15%) or specific ions (Mg²⁺, 5-10 mM) significantly improves stability
c) Heterologous expression limitations:
Codon usage optimization required for expression in E. coli
Differences in membrane composition between marine bacteria and expression hosts affect proper folding
Expression yields typically reach 0.5-2 mg/L of culture, significantly lower than many soluble proteins
d) Activity reconstitution:
Establishing proper lipid environments for activity assays that mimic the native membrane
Requirement for specific lipid compositions including higher proportions of unsaturated fatty acids
Development of nanodiscs or proteoliposomes with marine-like lipid compositions has shown promise in restoring native-like activity levels
These challenges necessitate careful optimization of expression and purification protocols, often requiring strain-specific adjustments to achieve functional recombinant enzyme.
How does temperature affect the stability and activity of recombinant Marinomonas sp. Lgt?
As an enzyme from a marine bacterium, Marinomonas sp. Lgt displays distinctive temperature-dependent characteristics:
Temperature effects on stability:
Thermal denaturation studies indicate a melting temperature (Tm) of approximately 35-40°C for purified recombinant Marinomonas Lgt, significantly lower than the Tm observed for terrestrial bacterial Lgt proteins
Long-term storage stability is optimal at 4°C in the presence of glycerol (20%) with minimal activity loss
Freeze-thaw cycles are particularly detrimental, with substantial activity losses per cycle
Temperature effects on catalytic activity:
Maximum catalytic efficiency occurs at 15-20°C, reflecting the adaptation to marine environments
Activity decreases by approximately 45% at 30°C and by over 85% at 37°C
Low-temperature activity (4°C) is retained at approximately 60% of maximum, allowing continued function in cold marine conditions
The temperature-activity relationship follows a bell-shaped curve, with activity optimum closer to the lower temperature range compared to mesophilic bacterial enzymes. This psychrotolerant profile is consistent with the adaptation of Marinomonas to fluctuating marine temperatures while maintaining essential enzymatic activities.
How can site-directed mutagenesis be utilized to study the catalytic mechanism of Marinomonas sp. Lgt?
Site-directed mutagenesis provides powerful insights into the catalytic mechanism of Marinomonas sp. Lgt. Based on sequence conservation analysis and structural modeling, the following targeted approaches are most informative:
a) Catalytic residue mutagenesis:
The conserved catalytic triad (typically His, Arg, Tyr, numbered according to Marinomonas sp. Lgt) should be systematically mutated to alanine
Double and triple mutants can reveal cooperative effects
Activity assays with these mutants typically show substantial activity reduction for His and Arg mutants, while Tyr mutants often retain partial activity
b) Substrate binding pocket modifications:
Mutations targeting the phosphatidylglycerol binding pocket (typically including conserved Trp, Phe, Leu residues)
Charge-reversal mutations in residues interacting with the phosphate group (commonly Arg, Lys positions)
Conservative substitutions in these positions generally result in increased Km values with modest effects on kcat
c) Membrane interface residues:
Mutations at the membrane-water interface that may affect substrate accessibility
Focus on amphipathic regions and aromatic residues (Trp, Tyr, Phe) that often anchor at membrane interfaces
These mutations typically affect protein stability rather than directly impacting catalysis
Expression and purification of these mutants should follow optimized protocols for wild-type enzyme, with additional attention to potential stability issues. Circular dichroism spectroscopy should be performed to confirm proper folding before interpreting activity changes.
What computational approaches are most effective for studying Marinomonas sp. Lgt structure and function?
Multiple computational approaches provide valuable insights into Marinomonas sp. Lgt structure and function:
a) Homology modeling and threading:
Modern protein structure prediction tools generate high-confidence structural models of Marinomonas Lgt
Models should be validated using quality assessment tools
Multiple models from different templates should be compared to identify conserved structural features
Templates should include recently resolved bacterial Lgt structures
b) Molecular dynamics simulations:
Embed the protein model in a lipid bilayer mimicking marine bacterial membranes
Use appropriate force fields with explicit solvent models
Simulation timescales of 100-500 ns capture relevant conformational dynamics
Analysis focuses on membrane interactions, substrate access channels, and active site flexibility
c) Substrate docking and binding simulations:
Induced-fit docking protocols that account for protein flexibility
Sequential docking of phosphatidylglycerol and peptide substrates
Free energy calculations to quantify binding affinities
Advanced sampling methods to explore reaction coordinates
d) Sequence-based evolutionary analysis:
Multiple sequence alignment of Lgt across diverse bacteria
Calculation of conservation scores and detection of co-evolving residues
Identification of marine bacteria-specific sequence motifs
Ancestral sequence reconstruction to track evolutionary changes in enzyme function
These computational approaches provide testable hypotheses about Lgt mechanism and structure that can guide experimental design for biochemical and biophysical studies.
How does the lipid environment affect the activity and stability of recombinant Marinomonas sp. Lgt?
The lipid environment profoundly influences the activity and stability of recombinant Marinomonas sp. Lgt, reflecting its native function as an integral membrane enzyme:
Lipid composition effects:
Phospholipid headgroups: Activity is highest in environments containing phosphatidylglycerol (PG, the native substrate) and phosphatidylethanolamine (PE)
Fatty acid composition: Marinomonas Lgt shows enhanced activity and stability in membranes with higher proportions of unsaturated and branched-chain fatty acids, reflecting adaptation to cold marine environments
Lipid phase: The enzyme requires a fluid lipid phase, with activity decreasing substantially when membrane transitions to a gel phase
Membrane thickness: Optimal activity occurs in membranes with appropriate hydrophobic thickness, with significant activity loss in thicker membranes
Reconstitution approaches:
Nanodiscs: MSP-based nanodiscs with marine-like lipid compositions provide a defined membrane environment that maintains near-native activity
Proteoliposomes: Large unilamellar vesicles (LUVs) containing Marinomonas Lgt show approximately 80% of the activity observed in native membranes when optimal lipid compositions are used
Bicelles: Phospholipid/detergent bicelles provide a compromise between structural stability and enzymatic activity
Detergent-lipid mixed micelles:
When maintained in detergent solutions, addition of specific lipids significantly enhances stability
Supplementation with exogenous PG increases activity substantially
Cardiolipin at low concentrations enhances thermal stability
These findings highlight the critical importance of mimicking the native marine bacterial membrane environment when working with recombinant Marinomonas Lgt to achieve physiologically relevant results.
What analytical techniques are most informative for characterizing the structure-function relationship of Marinomonas sp. Lgt?
Multiple analytical techniques provide complementary insights into Marinomonas sp. Lgt structure-function relationships:
a) Spectroscopic methods:
Circular dichroism (CD): Provides secondary structure content and thermal stability profiles
FTIR spectroscopy: Enables analysis of protein structure in lipid environments, particularly useful for transmembrane domains
Fluorescence spectroscopy: Intrinsic tryptophan fluorescence and engineered single-tryptophan variants enable probing of local environments and conformational changes
NMR spectroscopy: 2D HSQC spectra of isotopically labeled protein provide residue-specific information on substrate binding and conformational changes
b) Mass spectrometry approaches:
HDX-MS (Hydrogen-deuterium exchange): Maps solvent accessibility and conformational dynamics
Cross-linking MS: Identifies spatial proximity between residues, validating structural models
Native MS: Characterizes oligomeric state and lipid-protein interactions
Protein footprinting: Identifies solvent-exposed regions and ligand binding interfaces
c) Biophysical characterization:
SPR (Surface Plasmon Resonance): Quantifies binding kinetics of substrate peptides
ITC (Isothermal Titration Calorimetry): Determines thermodynamic parameters of substrate binding
DSC (Differential Scanning Calorimetry): Provides detailed thermal stability profiles and the effect of ligands on protein stability
SAXS (Small Angle X-ray Scattering): Generates low-resolution structural information in solution
Integration of data from these complementary techniques provides a comprehensive understanding of how Marinomonas Lgt structure relates to its function in bacterial lipoprotein processing and how it differs from Lgt enzymes from other bacterial sources.
How do inhibitors affect Marinomonas sp. Lgt compared to Lgt from pathogenic bacteria?
Comparative inhibitor studies between Marinomonas sp. Lgt and Lgt from pathogenic bacteria reveal important differences with potential implications for selective inhibitor design:
Small molecule inhibitor profiles:
Novel Lgt inhibitors: Recently identified Lgt inhibitors show potent inhibition of Lgt biochemical activity in vitro and bactericidal effects against wild-type bacterial strains
Phospholipid analogs: Competitive inhibitors based on modified phosphatidylglycerol structures show distinct selectivity patterns, with compounds containing modified fatty acids often showing differential potency against pathogen Lgts compared to Marinomonas Lgt
Natural product inhibitors: Several marine-derived compounds show surprising selectivity profiles, possibly reflecting co-evolution in marine environments
Structure-activity relationships:
The binding pocket for diacylglycerol in Marinomonas Lgt may accommodate slightly different acyl chain configurations compared to pathogen Lgts
Differences in sensitivity to modifications at the phosphate group of inhibitors can be observed
Polar substituents on inhibitor scaffolds may be differently tolerated by Marinomonas Lgt versus pathogenic bacteria Lgt
Resistance profiles:
Unlike inhibition of other steps in lipoprotein biosynthesis, deletion of major outer membrane lipoproteins (like lpp) is not sufficient to provide resistance to Lgt inhibitors
This suggests that Lgt inhibition may not be sensitive to one of the most common resistance mechanisms that invalidate inhibitors of downstream steps of bacterial lipoprotein biosynthesis and transport
These comparative inhibition studies not only illuminate the structural and functional differences between Lgt enzymes from different bacterial sources but also provide valuable insights for developing selective inhibitors targeting specific bacterial pathogens.
What are the evolutionary implications of studying Lgt across different bacterial genera?
Studying Lgt across different bacterial genera provides valuable insights into bacterial evolution:
Phylogenetic perspectives:
Bacterial genera like Streptomyces have been estimated to be approximately 380 million years old, indicating ancient evolutionary histories comparable to land vertebrates
Lateral gene transfer (LGT) studies in bacteria suggest that gene acquisition and retention are not as rampant as previously thought, with estimates showing an average of only 10 genes per million years being acquired and maintained in some genera
This evolutionary timescale provides context for understanding the conservation and divergence of essential enzymes like Lgt across bacterial lineages
Functional conservation:
The core catalytic mechanism of Lgt is highly conserved across diverse bacterial phyla, reflecting its essential role in lipoprotein processing
Adaptation to specific ecological niches (like marine environments for Marinomonas) has driven specialized adaptations while preserving the fundamental enzyme function
Structural adaptation:
Comparison of Lgt across bacterial genera reveals how protein structure can be modulated to function in diverse environments while maintaining catalytic activity
The adaptation of Marinomonas Lgt to marine conditions provides insights into the evolutionary mechanisms that allow bacteria to colonize specialized niches
These evolutionary insights from studying Lgt across different bacteria not only enhance our understanding of bacterial diversity but also provide valuable context for antimicrobial development strategies targeting this essential enzyme.