Recombinant Marinomonas sp. UPF0060 membrane protein Mmwyl1_1139 (Mmwyl1_1139)

Shipped with Ice Packs
In Stock

Description

Production and Applications

This recombinant protein is produced via bacterial expression systems, primarily in E. coli, with the following specifications:

ParameterValue
HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL); add 5–50% glycerol for long-term storage

The His tag facilitates purification via nickel affinity chromatography, enabling downstream applications such as structural studies, enzymatic assays, or ELISA-based detection .

Research Context and Organism Background

The source organism, Marinomonas sp. MWYL1, was isolated from the rhizosphere of Spartina anglica, a salt marsh grass in North Norfolk, England . While this strain is known for its role in dimethylsulfoniopropionate (DMSP) catabolism in marine environments , the specific function of Mmwyl1_1139 remains uncharacterized in publicly available literature.

Current Knowledge Gaps

The available data primarily focus on production parameters rather than functional biology:

  • Unresolved Functions: No enzymatic activity, pathway involvement, or interaction partners are documented in public databases .

  • Structural Insights: Limited crystallographic or cryo-EM data exist to elucidate its membrane topology or ligand-binding sites.

  • Ecological Relevance: The protein’s role in the bacterium’s adaptation to salt marsh environments remains speculative.

Comparative Analysis

While direct functional data are lacking, the protein’s UPF0060 classification suggests membership in a poorly characterized family of membrane proteins. Below is a hypothetical comparison with other UPF0060 proteins (based on sequence homology):

FeatureMmwyl1_1139Hypothetical UPF0060 Proteins
Length110 aaTypically 100–150 aa
Membrane DomainsPredicted 2–3 TMDsVariable (1–5 TMDs)
Conserved MotifsNone reportedPotential substrate-binding sites
Expression HostE. coliE. coli, insect cells, or mammalian cells

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Mmwyl1_1139; UPF0060 membrane protein Mmwyl1_1139
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Marinomonas sp. (strain MWYL1)
Target Names
Mmwyl1_1139
Target Protein Sequence
MPELKTISLFMLTALAEIIGCYLPYLWLREGKTIWLLVPAALSLAVFTWLLTLHPTASGR VYAAYGGVYIFMAVLWLWIVDGIRPTTWDMIGSAVALLGMAIIMFAPRTT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are typically used for recombinant production of Mmwyl1_1139?

For recombinant production of Mmwyl1_1139, Escherichia coli is the predominant expression system due to its efficiency and scalability. Based on commercial recombinant protein information, the protein is typically expressed with an N-terminal His tag to facilitate purification .

The methodology for expression involves:

  • Cloning the full-length gene (1-110 amino acids) into an expression vector

  • Transformation into E. coli expression strains

  • Induction of protein expression (typically using IPTG for T7-based systems)

  • Cell lysis and protein extraction

  • Purification using immobilized metal affinity chromatography (IMAC)

  • Storage in Tris-based buffer with 50% glycerol for stability

For membrane proteins like Mmwyl1_1139, specialized E. coli strains (such as C41/C43(DE3) or Lemo21(DE3)) may be preferred to minimize toxicity and improve proper membrane insertion during expression.

What purification strategies are most effective for Mmwyl1_1139?

The most effective purification strategy for Mmwyl1_1139 involves a multi-step approach that accounts for its membrane protein nature:

  • Initial solubilization: Use of appropriate detergents (e.g., n-dodecyl-β-D-maltoside (DDM), LDAO, or Triton X-100) to extract the membrane protein

  • Affinity chromatography: Utilizing the His-tag for IMAC purification (Ni-NTA columns)

  • Buffer optimization: Maintaining Tris-based buffers (pH 8.0) with 6% trehalose to enhance stability

  • Storage conditions: Aliquoting with 50% glycerol and storing at -20°C/-80°C to prevent freeze-thaw degradation

  • Working solution preparation: Reconstitution in deionized sterile water to concentrations of 0.1-1.0 mg/mL for experimental use

For experimental applications requiring higher purity, size exclusion chromatography can be employed as a polishing step after initial IMAC purification to achieve >90% purity as typically confirmed by SDS-PAGE .

What are the optimal conditions for handling and storing recombinant Mmwyl1_1139?

Based on commercial product information and standard membrane protein handling practices, the optimal conditions for Mmwyl1_1139 are:

Storage conditions:

  • Long-term storage: -20°C to -80°C in Tris/PBS-based buffer with 50% glycerol at pH 8.0

  • Lyophilized form: Stable at -20°C (preferred for extended storage periods)

Handling recommendations:

  • Brief centrifugation of vials before opening to bring contents to the bottom

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) for working aliquots

  • Storage of working aliquots at 4°C for up to one week

  • Avoiding repeated freeze-thaw cycles, which significantly reduce protein activity

Stability considerations:

  • The addition of 6% trehalose to storage buffer enhances protein stability

  • Working aliquots should be prepared in volumes appropriate for single-use applications

What experimental approaches are most effective for studying the structure-function relationship of Mmwyl1_1139?

For studying the structure-function relationship of Mmwyl1_1139, a multi-faceted experimental approach is recommended:

Structural analysis techniques:

  • X-ray crystallography: Requires initial screening of crystallization conditions using membrane protein-specific methods (lipidic cubic phase or bicelle crystallization)

  • Cryo-electron microscopy: Particularly useful if the protein forms larger complexes

  • NMR spectroscopy: For dynamics studies and solution structure of specific domains

  • Circular dichroism (CD): To determine secondary structure composition and stability

Functional characterization:

  • Liposome reconstitution assays: To study potential transport or channel activities

  • Site-directed mutagenesis: Targeting conserved residues based on sequence alignments with other UPF0060 family proteins

  • Bacterial complementation: Testing if the protein can complement phenotypes in E. coli membrane protein mutants

Bioinformatic approaches:

  • Comparative analysis with other UPF0060 family proteins

  • Protein topology prediction using tools specialized for membrane proteins

  • Homology modeling based on structurally characterized membrane proteins

For comprehensive structure-function studies, combining these approaches in a systematic manner will yield the most valuable insights. The experimental design should follow protocols similar to those used for other marine bacterial membrane proteins, such as those from Marinomonas mediterranea, where transposon mutagenesis has been successfully employed .

How can researchers develop effective experimental controls when studying Mmwyl1_1139 in functional assays?

Developing effective experimental controls for Mmwyl1_1139 functional assays requires a systematic approach that addresses both positive and negative controls at multiple levels:

Protein-level controls:

  • Inactive mutant: Generate site-directed mutants of conserved residues (identified through sequence alignment) to serve as negative controls

  • Related UPF0060 proteins: Include characterized family members from other bacteria as functional benchmarks

  • Tag-only control: Express and purify the tag portion alone to control for tag-specific effects

  • Heat-denatured sample: Use heat-inactivated protein to control for non-specific effects

System-level controls:

  • Empty vector control: For cellular assays, include cells transformed with empty expression vector

  • Non-target membrane protein: Include an unrelated membrane protein of similar size to control for general membrane effects

  • Buffer-only control: Include samples with purification buffer but no protein

Validation controls:

  • Western blot verification: Confirm protein expression and stability throughout the assay

  • Mass spectrometry: Verify protein identity and integrity, similar to the approach used for Marinomonas mediterranea proteins

  • Circular dichroism: Ensure proper folding before functional assays

When designing these controls, researchers should implement a pre-experimental test phase, similar to the systematic approach used in studying membrane proteins from Marinomonas mediterranea MMB-1, where multiple control conditions were carefully evaluated .

What are the potential functions of Mmwyl1_1139 based on comparative genomics with other Marinomonas species?

Comparative genomics analyses suggest several potential functions for Mmwyl1_1139 based on patterns observed across Marinomonas species and related marine bacteria:

Predicted functional roles:

  • Membrane transport: The protein topology suggests it may function in small molecule or ion transport, similar to other membrane proteins in marine bacteria that facilitate adaptation to marine environments

  • Cell envelope integrity: May contribute to membrane stability under varying salinity conditions, which is crucial for marine bacteria like Marinomonas that grow optimally in 2-2.5% NaCl

  • Signaling or sensing: Potentially involved in environmental sensing, similar to membrane proteins characterized in Marinomonas mediterranea

  • Bacteriocin interaction: Possible role in bacteriocin resistance or sensitivity, given that Marinomonas mediterranea produces R-type bacteriocins

A systematic transcriptomic analysis across different growth conditions, similar to approaches used with Marinomonas mediterranea, would help elucidate the regulation and potential function of this protein .

How can researchers apply transposon mutagenesis to study the physiological role of Mmwyl1_1139 in Marinomonas sp. MWYL1?

Transposon mutagenesis represents a powerful approach for studying the physiological role of Mmwyl1_1139, drawing upon established protocols for Marinomonas species:

Methodological workflow:

  • Selection of appropriate transposon system:

    • Mini-Tn10 transposons have shown higher frequency of insertions in Marinomonas species

    • R6K-based suicide delivery vectors mobilizable by conjugation are recommended

  • Conjugation protocol:

    • Grow donor E. coli S17-1 (λpir) containing the transposon construct in LB medium

    • Grow recipient Marinomonas sp. MWYL1 in marine medium to exponential phase

    • Mix cultures on marine agar plates (40 μl each) and incubate overnight

    • Collect cells by scraping and suspend in 1 ml of marine medium

    • Plate on selective media with appropriate antibiotics

  • Mutant screening strategy:

    • Primary screen: Select transconjugants on media containing appropriate antibiotics

    • Secondary phenotypic screens: Assess growth rates, stress resistance, or other relevant phenotypes

    • Confirmation of insertion: Southern blot analysis with transposon-specific probes

  • Characterization of mutants:

    • Determine the exact insertion site by sequencing transposon-flanking regions

    • Conduct complementation studies with wild-type Mmwyl1_1139 to confirm phenotype specificity

    • Perform comparative proteomics between wild-type and mutant strains

This approach was successfully implemented for Marinomonas mediterranea, where transposon mutagenesis led to the identification and characterization of important membrane proteins .

What methodological approaches can resolve contradictory data regarding membrane protein topology predictions for Mmwyl1_1139?

Resolving contradictory membrane protein topology predictions for Mmwyl1_1139 requires a multi-faceted experimental approach:

Experimental topology mapping methods:

  • Substituted cysteine accessibility method (SCAM):

    • Introduce cysteine residues at strategic positions

    • Test accessibility using membrane-impermeable thiol-reactive reagents

    • Compare accessibility in intact cells versus membrane preparations

  • Reporter fusion approach:

    • Create fusion proteins with reporters that have defined localization requirements

    • Use alkaline phosphatase (PhoA) for periplasmic domains and green fluorescent protein (GFP) for cytoplasmic domains

    • Analyze activity/fluorescence to determine orientation

  • Protease protection assays:

    • Expose membrane preparations to proteases

    • Identify protected fragments using mass spectrometry

    • Compare results with predicted topology models

  • Cross-linking studies:

    • Use membrane-impermeable cross-linkers to identify surface-exposed residues

    • Analyze cross-linked products by mass spectrometry

Integration and consensus building:

  • Create a decision matrix weighing evidence from each method

  • Develop a consensus model that accounts for all experimental data

  • Validate the consensus model with targeted experiments

This methodological framework has been successfully applied to resolve contradictory topology predictions for other bacterial membrane proteins and could be adapted for Mmwyl1_1139 .

How can researchers design experiments to investigate potential interactions between Mmwyl1_1139 and other membrane components in Marinomonas sp. MWYL1?

Investigating protein-protein and protein-lipid interactions for Mmwyl1_1139 requires a comprehensive experimental design:

Protein-protein interaction methods:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against Mmwyl1_1139 or use anti-His antibodies for the recombinant protein

    • Perform Co-IP from solubilized membrane fractions

    • Identify interacting partners by mass spectrometry

  • Bacterial two-hybrid system:

    • Adapt membrane-specific bacterial two-hybrid systems

    • Create a library of potential interacting partners from Marinomonas sp. MWYL1

    • Screen for positive interactions under various conditions

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Treat intact cells or membrane preparations with membrane-permeable cross-linkers

    • Purify Mmwyl1_1139 complexes and analyze by mass spectrometry

    • Identify cross-linked peptides to map interaction interfaces

Protein-lipid interaction methods:

  • Lipid binding assays:

    • Perform lipid overlay assays using purified protein

    • Use liposome flotation assays with different lipid compositions

    • Measure changes in protein behavior with different lipids

  • Native mass spectrometry:

    • Analyze protein-lipid complexes under native conditions

    • Identify specifically bound lipids

Integration with functional studies:

Interaction TypeMethodOutcome MeasureControl
Protein-proteinCo-IP/MSInteracting proteinsNon-specific IgG
Protein-proteinBacterial two-hybridReporter activationEmpty vector pairs
Protein-lipidLiposome bindingFlotation behaviorHeat-denatured protein
Protein-lipidNative MSBound lipid speciesDetergent-only samples

This experimental approach is informed by successful interaction studies of membrane proteins in other marine bacteria like Marinomonas mediterranea, where protein-protein interactions were critical for understanding membrane protein function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.