Recombinant Mastigocladus laminosus Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mastigocladus laminosus Cytochrome b6-f Complex Iron-Sulfur Subunit (petC)

The cytochrome $$b_6f $$ complex is an essential component of the photosynthetic electron transport chain in cyanobacteria, algae, and plants . It mediates electron transfer between photosystem II and photosystem I, and generates a proton gradient across the thylakoid membrane that drives ATP synthesis . The complex is a dimer, with each monomer composed of four core subunits (PetA, PetB, PetC, and PetD) and several smaller subunits (PetG, PetL, PetM, and PetN) .

The iron-sulfur subunit (petC), also known as the Rieske iron-sulfur protein (RISP), is a crucial component of the cytochrome $$b_6f $$ complex . PetC contains a [2Fe-2S] cluster that participates in electron transfer . The structure and function of the cytochrome $$b_6f $$ complex have been extensively studied in the thermophilic cyanobacterium Mastigocladus laminosus . The recombinant form of the Mastigocladus laminosus cytochrome $$b_6f $$ complex iron-sulfur subunit (petC) is produced using genetic engineering techniques, allowing for detailed biochemical and structural analyses .

Functional Aspects of PetC

The primary function of the cytochrome $$b_6f $$ complex is to transfer electrons from photosystem II to photosystem I . This process involves the oxidation of plastoquinol at the quinol oxidation (QoQ_o) site and the reduction of plastocyanin or cytochrome $$c_6$$ at the quinone reduction (QiQ_i) site . The PetC subunit plays a critical role in the QoQ_o site, where it accepts electrons from plastoquinol .

The [2Fe-2S] cluster in PetC undergoes redox changes during electron transfer, cycling between the oxidized (Fe^{3+}\) and reduced (Fe^{2+}\) states . The efficient transfer of electrons by PetC is essential for maintaining the proton gradient across the thylakoid membrane, which is used to drive ATP synthesis .

Research Findings and Applications

Research on the recombinant Mastigocladus laminosus cytochrome $$b_6f $$ complex iron-sulfur subunit (petC) has provided valuable insights into the structure and function of this important protein complex. Studies have investigated the effects of mutations in PetC on electron transfer efficiency and complex stability .

For example, the mutation of Pro171 to Leu in PetC (PETC-P171L) in Arabidopsis does not affect the stability of the $$b_6f $$ complex but suppresses electron transfer . Immunoblot analyses have shown that the PETC-P171L cells accumulate PETC and PetA at wild-type levels, indicating that the mutation does not affect the stability of the $$b_6f $$ complex .

Recombinant PetC has also been used in structural studies to determine the interactions of the subunit with other components of the $$b_6f $$ complex and with inhibitors . These studies have provided a detailed understanding of the electron transfer pathway and the mechanism of quinone binding .

Table: Properties of Recombinant Mastigocladus laminosus Cytochrome $$b_6f $$ Complex Iron-Sulfur Subunit (petC)

PropertyDescription
SourceMastigocladus laminosus
SubunitpetC (Rieske iron-sulfur protein)
Molecular WeightVaries depending on the presence of tags (e.g., His-tag)
Cofactor[2Fe-2S] cluster
FunctionElectron transfer from plastoquinol to cytochrome f in the cytochrome $$b_6f $$ complex
Expression SystemE. coli
PurificationAffinity chromatography (e.g., Ni-NTA for His-tagged protein)
StorageTris-based buffer with 50% glycerol at -20°C
Amino Acid SequenceMAQFTESMDVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. Please specify your desired tag type for prioritized development.
Synonyms
petC; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Mastigocladus laminosus (Fischerella sp.)
Target Names
petC
Target Protein Sequence
MAQFTESMDVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKL GNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAA ENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the iron-sulfur subunit (petC) play in electron transfer?

The cytochrome b6-f complex is a dimeric membrane protein complex with a molecular weight of approximately 220,000 Da that functions as a crucial electron transfer intermediate in oxygenic photosynthesis. The complex carries out electron transfer coupled to proton translocation and contains eight different transmembrane polypeptides . The iron-sulfur subunit (petC), also known as the Rieske iron-sulfur protein, is one of three polypeptide subunits that bind electron transfer cofactors, specifically containing a Fe2S2 cluster that plays a vital role in p-side electron transfer .

The Rieske iron-sulfur protein accepts electrons from plastoquinol (PQH2) at the Qp site of the complex and transfers them to cytochrome f, forming part of the electron transport chain between photosystem II and photosystem I . This process contributes to building the proton gradient necessary for ATP synthesis.

What is the subunit composition of the cytochrome b6-f complex from M. laminosus?

The cytochrome b6-f complex from M. laminosus contains eight distinct subunits with the following measured masses determined by electrospray ionization mass spectrometry:

SubunitCalculated Mass (Da)Measured Mass (Da)
PetA (cyt f)32,27032,270
PetB (cyt b6)24,88424,710
PetC (Rieske iron-sulfur protein)19,20219,295
PetD (subunit IV)17,52217,528
PetGnot applicable4,057
PetM3,8423,841
PetL3,5303,530
PetN3,3043,304
Total mass of the monomernot applicable108,535

The complex exists as a dimer with a total molecular weight of approximately 220,000 Da . Three of these subunits (PetA, PetB, and PetC) bind electron transfer cofactors, including cytochrome f (c-type heme), cytochrome b6 (two b hemes and heme x), and the Rieske iron-sulfur protein (Fe2S2 cluster), respectively .

What purification strategies are most effective for isolating the cytochrome b6-f complex from M. laminosus?

Highly active cytochrome b6-f complexes from M. laminosus have been successfully isolated using a combination of techniques:

  • Initial Separation: Membrane solubilization with appropriate detergents, typically followed by ammonium sulfate precipitation

  • Chromatographic Techniques:

    • Size-exclusion chromatography

    • Reverse-phase separations

    • Ion exchange chromatography

  • Analytical Verification:

    • Liquid chromatography with electrospray ionization mass spectrometry (LCMS+) has been effectively used to analyze the purified complex

    • Both size-exclusion and reverse-phase separations can be employed to separate protein subunits, allowing measurement of their molecular masses with an accuracy exceeding 0.01% (±3 Da at 30,000 Da)

  • Quality Control:

    • Spectroscopic analysis to verify cofactor content and functional integrity

    • Assessment of electron transfer activity to ensure the complex retains functionality

The purification process must be performed under conditions that maintain the integrity of the protein complex and preserve its enzymatic activity.

What expression systems have been successfully used for recombinant production of M. laminosus petC?

While the search results don't specifically detail expression systems for M. laminosus petC, research on related proteins provides insight into viable approaches:

  • E. coli Expression Systems:

    • The pET expression system in E. coli BL21(DE3) has been successfully used for expressing cyanobacterial proteins, including other components of photosynthetic complexes

    • Dual plasmid systems incorporating plasmids like pHO-PcyA, pCDF-derivatives, pCOLA-derivatives, or pET-derivatives under appropriate antibiotic selections have proven effective for expressing cyanobacterial proteins

  • Expression Conditions:

    • Lower temperatures (18-20°C) are often crucial for proper folding of complex proteins

    • Induction with IPTG (1 mM) followed by extended expression periods (12-18 hours) has yielded functional proteins

  • Iron-Sulfur Cluster Formation:

    • Co-expression with iron-sulfur cluster assembly machinery genes may be necessary for proper incorporation of the Fe2S2 cluster

    • Supplementation of the growth medium with iron sources can enhance cluster formation

For researchers attempting recombinant expression of M. laminosus petC, adapting these strategies would be a reasonable starting point, with optimization required for the specific protein.

How can the functional integrity of recombinant petC be assessed in vitro?

Multiple complementary approaches can be used to assess the functional integrity of recombinant petC:

  • Spectroscopic Analysis:

    • UV-visible absorption spectroscopy to verify characteristic absorption patterns of the Fe2S2 cluster

    • Electron paramagnetic resonance (EPR) spectroscopy to confirm the presence and integrity of the iron-sulfur cluster

    • Circular dichroism (CD) spectroscopy to assess secondary structure integrity

  • Electron Transfer Activity:

    • Measure electron transfer rates using artificial electron donors and acceptors

    • Monitor cytochrome f reduction kinetics in single-turnover measurements (typical half-times range from 43±23 ms to 74±8 ms depending on conditions)

  • Inhibitor Binding Studies:

    • Assess binding of quinone analogue inhibitors like tridecylstigmatellin (TDS) or DBMIB

    • Determine inhibitor sensitivity, which can indicate proper formation of the Qp binding site

  • Structural Analysis:

    • Limited proteolysis to assess proper protein folding

    • Mass spectrometry to confirm the expected molecular weight and potential post-translational modifications

A comprehensive assessment would include multiple methods to verify both structural integrity and functional activity of the recombinant protein.

How do mutations in the hinge region of petC affect electron transfer rates in the cytochrome b6-f complex?

The hinge region of the Rieske iron-sulfur protein is critical for its function, allowing movement of the Fe2S2 cluster domain during electron transfer. Research has revealed surprising functional characteristics of this region in cyanobacterial petC:

  • Functional Insensitivity to Structure Changes:

    • Unlike the bc1 complex, where the hinge region is sensitive to structural perturbation, the cytochrome b6-f complex exhibits remarkable tolerance to hinge region modifications

    • Experiments with Synechococcus sp. PCC 7002 showed that b6-f function was insensitive to changes in the hinge region that:

      • Increased flexibility

      • Decreased flexibility by substitution of 4-6 proline residues

      • Shortened the hinge by a 1-residue deletion

      • Elongated it by insertion of 4 residues

  • Threshold for Functional Impairment:

    • Deletion of 2 residues resulted in decreased activity and loss of inhibitor sensitivity

    • This establishes a minimum hinge length of 7 residues required for optimum binding of the iron-sulfur protein at the Qp site

  • Effect on Inhibitor Sensitivity:

    • Elongation of the hinge region by 4 residues increased sensitivity to Qp inhibitors

    • This suggests that hinge length modulates interaction with quinone analogue inhibitors and potentially affects natural substrate binding

These findings indicate that while the hinge region of petC in cyanobacteria demonstrates remarkable structural plasticity without loss of function, extreme modifications that disrupt the geometry of interactions at the Qp site can impair electron transfer activity.

Why do some cyanobacteria contain multiple petC genes, and what are their functional differences?

Some cyanobacteria contain multiple petC genes encoding different Rieske iron-sulfur proteins, which represents an unusual evolutionary adaptation not seen with other subunits of the cytochrome b6-f complex:

  • Multiple petC Genes in Synechocystis:

    • The genome of Synechocystis PCC 6803 contains three petC genes (petC1, petC2, petC3), all encoding potential Rieske subunits

    • Each of these genes can be deleted individually without dramatically altering the phenotype

    • Double deletion experiments revealed that petC1 and petC2 cannot be deleted in combination, whereas petC3 can be deleted together with either of the other two genes

  • Functional Differences:

    • PetC1 is the predominant Rieske isoform with the primary role in photosynthetic electron transfer

    • PetC2 can partly replace PetC1 function but likely has some distinct roles

    • PetC3 cannot functionally replace either PetC1 or PetC2 and may interact with a special electron donor with a lower redox potential than plastoquinone

  • Expression Patterns:

    • The different petC genes show distinct patterns of expression under various environmental conditions

    • This suggests specialized roles for each isoform in response to changing environmental conditions

  • Evolutionary Significance:

    • The presence of multiple petC genes may provide metabolic flexibility to cyanobacteria, allowing them to optimize electron transfer under diverse environmental conditions

    • It potentially represents an adaptation to the dual role of the cytochrome b6-f complex in both photosynthetic and respiratory electron transfer chains in cyanobacteria

This genetic redundancy with functional specialization appears to be a unique feature of the Rieske iron-sulfur protein within the cytochrome b6-f complex, not observed for other subunits.

What structural differences exist between the cytochrome b6-f complex from M. laminosus and other organisms?

Comparative structural analyses have revealed both similarities and important differences between the cytochrome b6-f complexes from different organisms:

These structural differences may reflect evolutionary adaptations to different ecological niches, such as the high-temperature environments inhabited by M. laminosus.

How does the petC protein from thermophilic M. laminosus differ from mesophilic homologs to maintain stability at high temperatures?

M. laminosus is a thermophilic cyanobacterium found in hot springs with temperatures ranging from 39-56°C, and its proteins, including petC, have adapted to maintain stability and function under these conditions:

These adaptations allow the petC protein and the entire cytochrome b6-f complex from M. laminosus to maintain functional integrity at temperatures that would denature proteins from mesophilic organisms.

What techniques are most effective for characterizing the thermal stability of recombinant M. laminosus petC?

Researchers investigating the thermal properties of recombinant M. laminosus petC can employ several complementary techniques:

  • Differential Scanning Calorimetry (DSC):

    • Measures the heat capacity of the protein as a function of temperature

    • Provides thermodynamic parameters (ΔH, ΔS, ΔG) of thermal unfolding

    • Can detect multiple unfolding transitions that may correspond to different domains

  • Circular Dichroism (CD) Spectroscopy:

    • Monitors changes in secondary structure as a function of temperature

    • Far-UV CD (190-250 nm) tracks secondary structure changes

    • Near-UV CD (250-350 nm) can provide information about tertiary structure and the environment of aromatic residues

  • Functional Assays at Various Temperatures:

    • Electron transfer activity measurements at different temperatures

    • Can establish the temperature optimum and range for functional activity

    • Temperature-dependent inhibition studies can reveal changes in binding site configuration

  • Thermal Shift Assays:

    • Fluorescence-based thermal shift assays using dyes like SYPRO Orange

    • Provides a rapid screening method for conditions that enhance thermal stability

    • Can be used to optimize buffer conditions for maximum stability

  • Dynamic Light Scattering (DLS):

    • Monitors changes in protein size distribution as a function of temperature

    • Can detect aggregation onset temperature

    • Useful for distinguishing between unfolding and aggregation processes

What insights do genomic analyses provide about the evolution of the cytochrome b6-f complex in thermophilic cyanobacteria?

Genomic and phylogenetic analyses provide several important insights into the evolution of the cytochrome b6-f complex in thermophilic cyanobacteria like M. laminosus:

  • Phylogeographic Distribution:

    • Studies have identified seven major lineages comprising 23 haplotypes in M. laminosus globally

    • The distribution of this thermophile in Asia revealed two distinct lineages with different cell sizes

    • These patterns suggest complex evolutionary history with potential geographic isolation followed by dispersal

  • Adaptive Radiation Along Temperature Gradients:

    • Investigation of M. laminosus distributed along the temperature gradient of White Creek (Yellowstone NP) identified 15 closely related lineages

    • These lineages show temperature-based niche differentiation, suggesting sympatric diversification along an ecological selection gradient

    • This provides evidence for microbial adaptive radiation in response to environmental gradients

  • Genetic Diversity:

    • The total nucleotide diversity at six nitrogen metabolism loci in M. laminosus was approximately three times greater than that observed in the human global population

    • This high genetic diversity exists despite identical 16S rRNA gene sequences, highlighting the importance of analyzing multiple genetic loci

  • Relationship with Other Species:

    • Genomic analysis suggests that M. laminosus UU774 has diverged from Fischerella sp. PCC 9339, another hot spring species isolated in the United States

    • The presence of shared preserved mutations indicates these species originated together before geographic separation and speciation

  • Gene Transfer Events:

    • There is evidence of gene transfers between filamentous cyanobacteria and their viruses that have influenced evolutionary trajectories

    • Some genetic elements show closer relationships to genes from proteobacteria than to those of other cyanobacteria, suggesting horizontal gene transfer events

These findings collectively demonstrate that the evolution of thermophilic cyanobacteria like M. laminosus, including their photosynthetic apparatus, has been shaped by a complex interplay of environmental adaptation, geographic isolation, and horizontal gene transfer.

How do different research groups approach the recombinant expression of thermostable proteins like M. laminosus petC?

Expressing thermostable proteins from organisms like M. laminosus presents both challenges and opportunities. Researchers employ several specialized approaches:

  • Selection of Expression Host:

    • Thermophilic expression hosts (e.g., Thermus thermophilus) may provide a more compatible cellular environment for thermostable proteins

    • Conventional E. coli strains with enhanced capacity for proper folding (e.g., Rosetta, Arctic Express, or SHuffle strains) are often used

    • E. coli BL21(DE3) with appropriate helper plasmids has been successful for expressing cyanobacterial proteins

  • Temperature Modulation Strategies:

    • Expression at reduced temperatures (18-20°C) to slow folding and improve yield of correctly folded protein

    • Heat shock steps during or after expression to promote proper folding

    • Temperature cycling protocols that mimic natural thermal fluctuations

  • Co-expression Systems:

    • Co-expression with chaperones like GroEL/GroES to assist proper folding

    • Co-expression with iron-sulfur cluster assembly machinery for proper incorporation of Fe-S clusters

    • Dual plasmid systems with appropriate antibiotic selections for co-expression of multiple components

  • Specialized Vector Design:

    • Inclusion of thermostable tags that enhance solubility

    • Codon optimization for the expression host while preserving critical sequence features

    • Fusion to thermostable protein partners that can be later removed by specific proteases

  • Post-Expression Processing:

    • Heat treatment of cell lysates to precipitate host proteins while retaining the thermostable target protein

    • Refolding protocols that leverage the inherent refolding capacity of thermostable proteins

    • In vitro reconstitution of iron-sulfur clusters under controlled conditions

These approaches must be tailored to the specific characteristics of the target protein, with optimization required for each new protein target.

What mass spectrometry techniques have proven most informative for characterizing the cytochrome b6-f complex and its petC subunit?

Mass spectrometry has been invaluable for detailed characterization of the cytochrome b6-f complex and its components:

  • Liquid Chromatography with Electrospray Ionization Mass Spectrometry (LCMS+):

    • Both size-exclusion and reverse-phase separations have been effectively used to separate protein subunits

    • This approach allows measurement of molecular masses with exceptional accuracy (exceeding 0.01%, ±3 Da at 30,000 Da)

    • Has enabled complete subunit coverage of the oligomeric intrinsic membrane protein complex

  • Tandem Mass Spectrometry (MSMS):

    • Used successfully to sequence low molecular weight protein subunits without prior cleavage

    • Can derive sequences from intact membrane proteins in the range of 3.2-4.2 kDa

    • Allows comparison with translations of genomic DNA sequence to identify potential discrepancies

  • Key Findings from Mass Spectrometry Analysis:

    • Identified eight subunits in the M. laminosus complex (PetA, PetB, PetC, PetD, PetG, PetL, PetM, and PetN)

    • Revealed that nuclear-encoded PetM was cleaved after import from the cytoplasm, while chloroplast-encoded proteins retained their initiating formylmethionine

    • Discovered a potential DNA sequencing error or RNA editing event in PetL from spinach, where Phe was detected at position 2 instead of the Ser coded in the chloroplast genome

  • Application to Recombinant Proteins:

    • Can verify correct expression and processing of recombinant petC

    • Enables detection of post-translational modifications

    • Allows precise determination of protein integrity and potential degradation products

Mass spectrometry analysis has emphasized that complete annotation of genomic data requires detailed expression measurements of primary structure, highlighting the value of these techniques for both structural and functional studies of the cytochrome b6-f complex.

How should researchers address the contradictory findings between different studies on petC function and structure?

Researchers encountering contradictory findings about petC function and structure should adopt a systematic approach to resolve inconsistencies:

  • Potential Sources of Discrepancies:

    • Species-specific differences (e.g., differences between M. laminosus and C. reinhardtii)

    • Methodological variations in protein preparation and analysis

    • Different experimental conditions (temperature, pH, ionic strength)

    • Capture of different functional states of a dynamic protein complex

  • Methodological Approach to Resolving Contradictions:

    • Direct Comparative Studies: Design experiments that directly compare proteins from different species under identical conditions

    • Multiple Complementary Techniques: Apply diverse analytical methods to build a more complete picture

    • Functional Context Analysis: Consider whether contradictory findings might reflect physiologically relevant alternative states

    • Computational Modeling: Use molecular dynamics simulations to explore the conformational landscape of petC

  • Case Study: Inhibitor Binding Differences:

    • Tridecylstigmatellin (TDS) binding differed significantly between M. laminosus and C. reinhardtii cytochrome b6-f complexes

    • In C. reinhardtii, the TDS headgroup enters the Qp pocket and hydrogen bonds with His155 of the iron-sulfur protein

    • In M. laminosus, TDS exhibits a novel binding orientation with its hydrocarbon tail plugging the narrow portal

    • This contradiction was resolved by recognizing that the crystals captured different functional states, suggesting the Qp pocket may alter its shape in response to ligand binding

  • Integrative Analysis Framework:

    • Consider evolutionary context and ecological adaptation

    • Evaluate data quality and experimental controls

    • Assess whether contradictions might reflect dynamic properties rather than experimental errors

    • Develop testable hypotheses that could resolve apparent contradictions

By systematically addressing contradictions through careful experimental design and integrative analysis, researchers can transform apparent conflicts in the literature into deeper insights about the structural dynamics and functional mechanisms of petC.

What bioinformatic tools are most useful for analyzing sequence conservation and structural features of petC across cyanobacterial species?

Researchers studying petC across cyanobacterial species can leverage numerous bioinformatic tools to analyze sequence conservation and structural features:

  • Sequence Analysis Tools:

    • Multiple Sequence Alignment: MUSCLE, CLUSTALW, or MAFFT for basic alignments

    • Conservation Analysis: ConSurf server to map conservation onto structures

    • Coevolution Analysis: PSICOV, DCA, or EVcouplings to identify co-evolving residues that might be structurally or functionally linked

    • Profile Hidden Markov Models: HMMER for sensitive sequence searches and domain identification

  • Structural Analysis Tools:

    • Structure Prediction: AlphaFold2 or RoseTTAFold for accurate structure prediction of petC proteins lacking experimental structures

    • Structural Alignment: TM-align or DALI for comparing structures across species

    • Molecular Dynamics Simulations: GROMACS or AMBER to explore conformational dynamics

    • Protein-Protein Docking: HADDOCK or ClusPro to model interactions with other components of the b6-f complex

  • Specific Features Analysis:

    • Iron-Sulfur Cluster Binding Sites: MetalPDB or MIB for analyzing metal-binding site conservation

    • Transmembrane Region Analysis: TMHMM or TOPCONS for predicting membrane-spanning regions

    • Hinge Region Analysis: DynaMine or FlexPred for flexibility prediction

    • Protein Stability Analysis: FoldX or Rosetta for estimating the effect of mutations on stability

  • Evolutionary Analysis Tools:

    • Phylogenetic Tree Construction: RAxML, IQ-TREE, or MrBayes for reconstructing evolutionary relationships

    • Selection Pressure Analysis: PAML or HyPhy to detect signatures of positive selection

    • Ancestral Sequence Reconstruction: FastML or PAML for inferring ancestral sequences

    • Horizontal Gene Transfer Detection: T-REX or HGTector to identify potential gene transfer events

  • Integrated Analysis Platforms:

    • Jalview: For visualization and analysis of multiple sequence alignments

    • MEGA: For comprehensive molecular evolutionary genetics analysis

    • PyMOL or UCSF Chimera: For structure visualization and analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.