Recombinant Mastigocladus laminosus Cytochrome b6-f complex subunit 4 (petD) is a recombinant protein derived from the thermophilic cyanobacterium Mastigocladus laminosus. This subunit is part of the cytochrome b6-f complex, which plays a crucial role in oxygenic photosynthesis by facilitating electron transfer between photosystems I and II, thereby generating a transmembrane electrochemical proton gradient essential for ATP synthesis .
The cytochrome b6-f complex is composed of several subunits, including four large subunits (cytochrome f, cytochrome b6, the Rieske iron-sulfur protein, and subunit IV) and four small hydrophobic subunits (PetG, PetL, PetM, and PetN) . Subunit 4, encoded by the petD gene, is one of the integral components of this complex. The structure of the b6-f complex from Mastigocladus laminosus has been resolved to a high resolution, revealing a large quinone exchange cavity and specific binding sites for plastoquinone and other inhibitors .
Protein Details: The recombinant protein is available in quantities such as 50 µg, with other quantities available upon request. It is produced as a recombinant protein in a suitable expression system .
Storage and Handling: The protein is stored in a Tris-based buffer with 50% glycerol at -20°C. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .
Amino Acid Sequence: The amino acid sequence of the protein is well-defined, starting with MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPA MVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKF QNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF .
The cytochrome b6-f complex, including subunit 4, is crucial for understanding the mechanisms of oxygenic photosynthesis. Research on this complex has provided insights into electron transfer processes and the generation of proton gradients necessary for ATP synthesis . The recombinant form of subunit 4 can be used in biochemical assays to study the assembly and function of the cytochrome b6-f complex.
| Characteristic | Description |
|---|---|
| Quantity | 50 µg (other quantities available) |
| Storage Buffer | Tris-based buffer, 50% glycerol |
| Storage Conditions | -20°C, avoid repeated freezing/thawing |
| Amino Acid Sequence | MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPA MVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKF QNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF |
| Protein Length | Full-length protein (1-160 amino acids) |
| Feature | Cytochrome b6-f Complex | Cytochrome bc1 Complex |
|---|---|---|
| Core Structure | Similar core structure | Similar core structure |
| Domain Arrangement | Different domain arrangement outside the core | Different domain arrangement outside the core |
| Prosthetic Groups | Includes c-type cytochrome f and Rieske iron-sulfur protein | Includes cytochrome c1 and Rieske iron-sulfur protein |
| Function | Electron transfer in photosynthesis | Electron transfer in respiration |
Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
The cytochrome b6-f complex (Cyt b6f) plays pivotal roles in both linear and cyclic electron transport of oxygenic photosynthesis in plants and cyanobacteria. The complex consists of 4 large subunits responsible for organizing the electron transfer chain within Cyt b6f, which have counterparts in the cytochrome bc1 complex in other bacteria, and 4 small subunits that are unique to oxygenic photosynthesis .
In cyanobacteria like Mastigocladus laminosus, the Cyt b6f complex serves as an essential intermediary in the photosynthetic electron transport chain, transferring electrons between photosystem II and photosystem I. Research has demonstrated that disruption of the complex significantly impacts photosynthetic efficiency, as evidenced by studies showing that loss of even small subunits like PetN can destabilize the entire complex, reducing oxygen evolution activity to approximately 30% of wild-type levels .
Researchers should be aware of the evolving taxonomy surrounding Mastigocladus laminosus. Certain varieties, such as Mastigocladus laminosus var. indicus, have been reclassified as Fischerella indica (Desikachary) Kastosvky & J.R.Johansen according to more recent phylogenetic analyses .
The genus Mastigocladus is often referred to with Fischerella in parentheses in recent literature (e.g., Mastigocladus (Fischerella) laminosus), reflecting ongoing taxonomic refinement . When publishing research or referencing strains, it's important to include collection identifiers (e.g., CALU 987 for reference strains) to provide clarity about the specific organisms under investigation .
Based on related research protocols, E. coli expression systems have been successfully employed for producing recombinant cyanobacterial proteins. For example, a phage ferredoxin (Fd) gene was cloned into a pET expression vector, overexpressed in Escherichia coli at 37°C, and purified using a combination of anion exchange and size exclusion chromatography, yielding approximately 0.6 mg/L of protein with >95% homogeneity as assessed by SDS-PAGE analysis .
A multi-step purification protocol is recommended based on successful approaches with related cyanobacterial proteins:
Initial capture: Anion exchange chromatography (e.g., Q-Sepharose or DEAE)
Intermediate purification: Size exclusion chromatography
Final polishing: If necessary, affinity chromatography with engineered tags
This approach has proven effective for the purification of cyanobacterial ferredoxins to >95% homogeneity . For cytochrome b6-f complex subunits specifically, consideration should be given to maintaining the iron-sulfur clusters during purification, potentially requiring anaerobic conditions and the inclusion of reducing agents in buffers.
Functional integrity can be evaluated through several complementary approaches:
Electron transfer assays: Cellular assays measuring electron transfer between known partners, similar to those used to assess electron transfer from ferredoxin-NADP+ reductase (FNR) to sulfite reductase (SIR)
Spectroscopic analysis: UV-visible spectroscopy to verify characteristic absorbance peaks associated with properly incorporated cofactors
Thermal stability assessment: Differential scanning calorimetry to determine melting temperatures and compare with native protein complexes
Partner protein binding assays: Surface plasmon resonance or isothermal titration calorimetry to measure interaction with known binding partners
Mastigocladus laminosus populations exhibit considerable genetic diversity despite identical 16S rRNA sequences. Research on two Yellowstone National Park populations revealed that nucleotide diversity at six nitrogen metabolism loci was approximately three times greater than that observed in the human global population . This genetic diversity likely extends to photosynthetic genes, including those encoding cytochrome b6-f complex components.
The two studied populations showed genetic differentiation despite their geographic proximity, suggesting limited gene flow between populations . This genetic differentiation may impact the expression and function of photosynthetic proteins, although direct evidence for differential cytochrome b6-f complex expression was not provided in the search results.
The relationship between environmental factors and gene expression is evident from studies showing that nitrogen availability dramatically affects phenotype expression in M. laminosus. Under nitrogen-limited conditions, heterocyst development and nitrogen fixation pathways are activated, while these genetic programs remain unexpressed when preferred nitrogen sources are available . Similar environmental response mechanisms may influence cytochrome b6-f complex expression and function.
Site-directed mutagenesis of the petD gene can be approached using several techniques:
Plasmid-based mutagenesis: Introducing the petD gene into a shuttle vector, performing mutagenesis in E. coli, and transferring the modified gene back into M. laminosus
CRISPR-Cas9 genome editing: Designing guide RNAs targeting specific regions of the petD gene for precise genomic modifications
Homologous recombination: Using natural transformation with linear DNA fragments containing desired mutations flanked by homologous sequences
When designing mutations, researchers should consider conserved residues identified through multiple sequence alignments of related proteins. For example, studies of cyanobacterial ferredoxins revealed different patterns of conservation for residues involved in interactions with different partner proteins . Similar analysis of petD would help identify critical residues for targeted mutagenesis.
Structural characterization using X-ray crystallography or cryo-electron microscopy can reveal the precise arrangement of subunits and cofactors within the complex. This structural information can guide rational design of synthetic electron transport components with enhanced properties.
Sequence similarity networks (SSNs) have been used to examine relationships between related proteins, such as cyanophage and cyanobacterial ferredoxins . Similar approaches could be applied to cytochrome b6-f complex components to identify structural features that might be transferable across species or optimizable for specific applications.
Structural studies can also reveal residues involved in protein-protein interactions, as demonstrated for ferredoxins where residues mediating interactions with partner proteins like FNR, PSI, and SIR were identified through crystal structures of protein complexes . This information is valuable for engineering improved electron transfer efficiency in synthetic systems.
While the search results don't provide direct comparisons of the cytochrome b6-f complex across cyanobacterial species, related studies on ferredoxins provide a framework for understanding protein relationships. Sequence identity analysis of ferredoxins revealed that most (5/7) cyanobacterial ferredoxins cluster tightly with ≥70% identity, while others exhibit a range of sequence identities (40-60%) .
Similar comparative analyses would likely reveal conserved core features of the cytochrome b6-f complex across cyanobacteria, with species-specific variations potentially related to environmental adaptations. The high conservation of residues involved in protein-protein interactions, as observed with ferredoxin-FNR interactions, suggests fundamental mechanisms of electron transfer are preserved across species .
The petD gene likely exhibits patterns of conservation and variation similar to those observed in other photosynthetic genes. Studies of two M. laminosus populations from different environments revealed substantial genetic differentiation despite identical 16S rRNA sequences . This suggests that functional genes like petD may evolve more rapidly in response to specific environmental pressures.
Population genetic models suggest that local adaptation in M. laminosus is mutation-limited but that populations are expected to continue to diverge due to low migratory gene flow . This ongoing divergence may lead to functional differences in the cytochrome b6-f complex across strains, potentially reflecting adaptations to different light environments or electron transport requirements.
The four small subunits of the cytochrome b6-f complex are unique to oxygenic photosynthesis, distinguishing it from the cytochrome bc1 complex found in other bacteria . While the specific functions of these small subunits remain to be fully elucidated, research demonstrates their importance for complex stability and function.
Studies on the PetN subunit in Anabaena variabilis revealed that its deletion destabilized the entire complex, reducing the amount of large subunits to 20-25% of wild-type levels . This destabilization had significant metabolic consequences:
Reduced oxygen evolution activity (~30% of wild-type)
Impaired linear and cyclic electron transfer
Largely reduced plastoquinone pool under normal light conditions
Higher PSII/PSI ratio than the wild type
Abolished state transitions
These findings strongly suggest that the small subunits, including those potentially interacting with the petD-encoded subunit, are critical for maintaining proper electron flow through the complex and for regulatory processes like state transitions .
Based on experiences with related cyanobacterial proteins, researchers may encounter several challenges:
Protein instability: Recombinant cyanobacterial proteins may exhibit limited thermal stability. For example, studies with a phage ferredoxin showed significant thermal instability at 37°C, requiring lower expression temperatures or increased expression levels to compensate .
Cofactor incorporation: Ensuring proper incorporation of iron-sulfur clusters and other cofactors may require supplementation of growth media and optimization of expression conditions.
Protein solubility: Membrane-associated components of the complex may present solubility challenges. Fusion tags or detergent optimization may be necessary for successful purification.
Low expression yields: As observed with some cyanobacterial proteins, yields may be limited (e.g., 0.6 mg/L) . Strategies to improve yields include codon optimization, use of stronger promoters or ribosome binding sites, and optimization of cell lysis conditions.
Functional validation can be approached through several complementary methods:
In vitro electron transfer assays: Using purified components to measure electron transfer rates between known partners
Complementation assays: Testing whether the recombinant protein can restore function in systems with deleted or inactivated native components
Comparative spectroscopy: Comparing spectroscopic properties (UV-visible, EPR, resonance Raman) with those of native complexes
Protein-protein interaction analysis: Verifying that recombinant components maintain appropriate interactions with partner proteins
A practical example comes from studies with cyanobacterial ferredoxins, where an aTc-regulated expression vector was used to test complementation in cellular assays, successfully demonstrating electron transfer function despite protein instability challenges .
Multiple analytical approaches provide complementary insights:
X-ray crystallography/cryo-EM: Revealing the three-dimensional structure and subunit arrangement
Hydrogen-deuterium exchange mass spectrometry: Identifying regions of protein dynamics and solvent accessibility
Cross-linking coupled with mass spectrometry: Mapping protein-protein interaction interfaces
Electron paramagnetic resonance (EPR): Characterizing the electronic properties of metal centers
Multiple sequence alignment: Identifying conserved residues that may be functionally critical
Mutagenesis coupled with activity assays: Directly testing the functional importance of specific residues
These approaches have been successfully applied to related systems, such as the analysis of ferredoxin interactions with partner proteins, where crystal structures revealed the specific residues mediating contacts in protein complexes .