Recombinant Mastigocladus laminosus Photosystem I reaction center subunit III (psaF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mastigocladus laminosus Photosystem I Reaction Center Subunit III (psaF)

The Recombinant Mastigocladus laminosus Photosystem I reaction center subunit III (psaF) is a component of the photosynthetic apparatus in cyanobacteria, specifically involved in the Photosystem I (PSI) complex. PSI is crucial for the light-dependent reactions of photosynthesis, where it plays a central role in electron transfer processes. The psaF subunit, while not essential for the basic electron transfer function in cyanobacteria, contributes to the efficiency and stability of these processes in other organisms like plants and algae.

Research Findings on psaF

Research on the psaF subunit has primarily focused on its role in plants and algae. For instance, studies using site-directed mutagenesis in Chlamydomonas reinhardtii have shown that specific lysine residues in the N-terminal domain of psaF are crucial for binding plastocyanin and facilitating electron transfer . In cyanobacteria, while psaF is not essential for electron transfer, its presence can influence the stability and efficiency of PSI complexes under certain conditions.

Table 1: Effects of Mutations in the N-terminal Domain of psaF on Electron Transfer

MutationEffect on Electron Transfer Rate Constants
K12PNo significant change relative to wild type
K16QReduced by a factor of 6
K23QReduced by a factor of 13
K30QReduced by a factor of 3

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaF; Photosystem I reaction center subunit III; PSI-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-165
Protein Length
Full Length of Mature Protein
Species
Mastigocladus laminosus (Fischerella sp.)
Target Names
psaF
Target Protein Sequence
LGADLVPCSESPAFQQRAQVARNTTADPESGKKRFERYSQALCGPEGLPHLIVDGRLDHA GDFLIPSILFLYIAGWIGWVGRAYLQTIKKQGSNVEQKEIQIELPIALPIMLSGFAWPAA AIKEFLSGELTAKDEEITISPR
Uniprot No.

Target Background

Function

This protein likely participates in the efficient electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). Its function as a plastocyanin-docking protein contributes to the specific binding of plastocyanin to Photosystem I.

Protein Families
PsaF family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural composition of Photosystem I in Mastigocladus laminosus?

Photosystem I reaction center isolated from the thermophilic cyanobacterium Mastigocladus laminosus contains four distinct subunits with molecular masses of approximately 70,000 daltons (subunit I), 16,000 daltons (subunit II), 11,000 daltons (subunit III), and 10,000 daltons (subunit IV) as determined by sodium dodecyl sulfate gel electrophoresis. The purified reaction center typically contains about 100 chlorophyll a molecules per P(700), although this can be depleted to approximately 50 chlorophyll a per P(700) without compromising photochemical activities. This composition demonstrates a structural organization similar to photosystem I reaction centers from higher plants and particularly to those isolated from green algae, indicating evolutionary conservation of core PSI components across diverse photosynthetic organisms.

How does psaF contribute to the function of Photosystem I?

The psaF subunit in Photosystem I plays a crucial role in facilitating electron transport processes, particularly in the docking and electron transfer from cytochrome c. In Mastigocladus laminosus, the reaction center actively participates in cytochrome c photooxidation, with the notable observation that photooxidation of acidic cytochromes (such as Euglena cytochrome 552) specifically requires the presence of cations. This requirement suggests that psaF may contribute to creating an appropriate electrostatic environment for interaction with negatively charged cytochrome proteins. The psaF gene is typically found in a conserved genomic locus that includes the closely positioned psaJ gene, indicating potential co-regulation or functional coordination between these PSI components.

What are the evolutionary implications of psaF conservation across species?

Immunological cross-reactivity studies demonstrate that subunits of photosystem I reaction centers from Mastigocladus laminosus, higher plants, and green algae share significant homology. This conservation provides biochemical evidence for the common evolutionary origin of photosystem I reaction centers across diverse photosynthetic organisms. In higher plants and green algae, subunit II is synthesized by cytoplasmic ribosomes, suggesting that a high degree of homology has been preserved during the evolutionary transfer of its gene from prokaryotes to the nucleus of eukaryotes. The genomic organization of psaF in relation to adjacent genes (psaJ and psaL) also shows patterns of conservation that can provide insights into the evolutionary history of photosynthetic apparatus development across cyanobacteria, algae, and plants.

What techniques are most effective for isolating recombinant psaF from Mastigocladus laminosus?

For effective isolation of recombinant psaF from Mastigocladus laminosus, a multi-step purification approach is recommended. Begin with gene amplification using specific primers designed to target the psaF region, followed by cloning into an appropriate expression vector such as pET-28a(+) using restriction enzymes like BamHI and XhoI. For optimal expression, the construct should include a His-tag to facilitate purification through affinity chromatography. After expression in a suitable host system, cell disruption should be performed under conditions that preserve protein structure (typically using a French press or sonication in a buffer containing 20 mM Tris-HCl pH 8.0, 500 mM NaCl, and 5% glycerol). The His-tagged recombinant psaF can then be purified using Ni-NTA affinity chromatography followed by size-exclusion chromatography to ensure high purity. For verification of structural integrity, the purified protein should be analyzed using SDS-PAGE, western blotting with anti-psaF antibodies, and circular dichroism spectroscopy to confirm proper folding.

How can researchers analyze PSI oligomeric states involving psaF?

Analysis of PSI oligomeric states involving psaF requires a combination of biochemical and imaging techniques. Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) is particularly effective for separating intact PSI complexes in their native oligomeric states (monomers, dimers, trimers, and tetramers). For this procedure, thylakoid membranes should be solubilized with n-dodecyl-β-maltoside (DDM) at a concentration of 1% with 0.4 mg/mL chlorophyll. Following BN-PAGE separation, transmission electron microscopy (TEM) can provide structural visualization of different oligomeric forms. When analyzing specifically how psaF contributes to these oligomeric structures, researchers should complement these approaches with crosslinking studies using agents like DSP (dithiobis(succinimidyl propionate)) followed by mass spectrometry to identify protein-protein interaction interfaces. Additionally, LC-MS/MS analysis of isolated oligomeric forms provides critical information about subunit composition and potential post-translational modifications that may affect oligomerization.

What genetic manipulation strategies can be employed to study psaF function?

To effectively study psaF function through genetic manipulation, several approaches can be implemented:

  • Gene replacement: Create knockout mutants by amplifying approximately 600 bp upstream and downstream of the psaF gene locus, then replace the gene with a selection marker such as a chloramphenicol resistance cassette. This construct can be introduced into wild-type Mastigocladus laminosus or model cyanobacteria like Synechocystis sp. PCC 6803 through bacterial conjugation or transformation.

  • Complementation studies: For functional verification, the open reading frame of psaF can be amplified and cloned into an expression vector like pPSBA2KS under control of a constitutive promoter, then reintroduced into the knockout strain.

  • Site-directed mutagenesis: To study specific functional domains, create point mutations at conserved residues using inverse PCR with primers containing the desired mutations.

  • Domain swapping: Replace specific regions of psaF with corresponding regions from other species to investigate evolutionary adaptations and functional domains.

For phenotypic analysis, these mutants should be characterized through growth measurements under different light conditions, oxygen evolution rates, P700 oxidation kinetics, and electron transport rates to assess the functional impact of the genetic modifications.

How does the structure of psaF relate to its electron transport capabilities?

The structure of psaF in Mastigocladus laminosus is intricately linked to its electron transport capabilities, particularly in mediating interactions with soluble electron donors. Analysis of the protein structure reveals transmembrane domains that anchor it within the thylakoid membrane, along with exposed hydrophilic regions that create docking sites for electron carriers like cytochrome c. The specific arrangement of charged amino acid residues on the lumenal side creates an electrostatic environment conducive to cytochrome binding. This structural configuration explains the experimental observation that the photooxidation of acidic cytochromes (such as Euglena cytochrome 552) requires the presence of cations, which likely neutralize repulsive charges and facilitate proper docking orientation. Comparative structural analyses with psaF from other cyanobacteria and plants suggest that while the core functional regions remain conserved, subtle variations in surface-exposed loops may tune electron transfer rates to specific physiological requirements of thermophilic environments in which Mastigocladus laminosus thrives.

What structural features distinguish psaF in Mastigocladus laminosus from its counterparts in other photosynthetic organisms?

The psaF subunit in Mastigocladus laminosus exhibits distinctive structural adaptations that differentiate it from counterparts in mesophilic cyanobacteria and higher plants. While maintaining the core functional domains, Mastigocladus laminosus psaF likely contains additional thermostabilizing features, including increased hydrophobic core packing, additional salt bridges, and reduced flexibility in loop regions. These adaptations contribute to the protein's stability at the elevated temperatures characteristic of the hot spring environments where this thermophilic cyanobacterium thrives. Despite these thermostabilizing modifications, immunological cross-reactivity studies demonstrate significant homology between psaF from Mastigocladus laminosus and its counterparts in higher plants and green algae, indicating that the functional core structure has been evolutionarily conserved while peripheral regions have adapted to different environmental niches. This balance between conservation and adaptation provides valuable insights into the molecular basis of protein thermostability while maintaining essential functionality.

How do post-translational modifications affect psaF function in PSI complexes?

Post-translational modifications (PTMs) of psaF play critical roles in regulating its integration into PSI complexes and its functional activity. While specific PTM data for Mastigocladus laminosus psaF is limited in the available literature, comparative analysis with related cyanobacterial systems suggests several potential modification sites. Phosphorylation of serine and threonine residues may regulate protein-protein interactions within the PSI complex, particularly at interfaces with neighboring subunits. Oxidative modifications, especially in cysteine residues, could serve as redox sensors that modulate electron transport activity in response to changing cellular redox states. Additionally, the N-terminal region of psaF may undergo processing during membrane integration to remove signal peptides or transit sequences. The precise mapping of these modifications requires advanced proteomic approaches, including enrichment strategies for phosphorylated peptides, redox proteomics for detecting oxidative modifications, and top-down proteomics for characterizing intact protein forms with their modification patterns. Understanding these PTMs provides critical insights into the dynamic regulation of PSI assembly and function in response to environmental changes.

How does the organization of PSI genes (including psaF) vary across different cyanobacterial lineages?

The genomic organization of PSI genes, including psaF, shows significant variation across cyanobacterial lineages, providing insights into evolutionary adaptations and functional specializations. In heterocyst-forming cyanobacteria and their close relatives, a distinctive pattern emerges where psaF is frequently found in a conserved operon structure alongside psaJ and psaL (psaF/J/L loci). This arrangement contrasts with other cyanobacterial groups that show alternative organizations. Phylogenetic analysis of these gene arrangements reveals that the psaF/J/L organization correlates strongly with the capability to form tetrameric PSI structures, suggesting co-evolution of these genes to enable specific oligomeric arrangements. Some cyanobacteria, particularly those capable of far-red light acclimation, possess multiple copies of certain PSI genes, including psaL, which may be expressed under specific environmental conditions. The table below summarizes representative patterns of PSI gene organization across different cyanobacterial groups:

Cyanobacterial GrouppsaF LocationAdjacent GenesPSI Oligomeric State
Heterocyst-formingpsaF/J/L locuspsaJ, psaLPrimarily tetrameric
Close relatives of HCRpsaF/J/L locuspsaJ, psaLTetrameric and trimeric
Distant cyanobacteriaVariableOften psaJPrimarily trimeric
Marine SynechococcusVariableVariablePrimarily monomeric

This diversity in genomic organization reflects the evolutionary history of PSI complexes and their adaptation to different ecological niches and light environments.

What experimental approaches can reveal interactions between psaF and other PSI subunits?

Multiple complementary experimental approaches can effectively reveal the interaction network between psaF and other PSI subunits:

  • Cross-linking mass spectrometry (XL-MS): Chemical cross-linkers that target specific amino acid residues (e.g., DSS for lysines, EDC for carboxyl and amine groups) can be used to covalently link interacting proteins. After digestion, cross-linked peptides are identified by mass spectrometry, revealing proximity relationships between psaF and other subunits.

  • Co-immunoprecipitation (Co-IP): Using antibodies specific to psaF, researchers can precipitate intact protein complexes from solubilized thylakoid membranes and identify interacting partners through western blotting or mass spectrometry.

  • Surface plasmon resonance (SPR): Purified recombinant psaF can be immobilized on a sensor chip to measure binding kinetics with other PSI subunits or electron transport partners.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of psaF that show protection from deuterium exchange when in complex with other subunits, indicating interaction interfaces.

  • Cryo-electron microscopy (cryo-EM): High-resolution structural analysis of intact PSI complexes can reveal the precise positioning of psaF and its contact points with neighboring subunits.

For recombinant systems, a modified approach involving the replacement of the PBS-binding domain with a His-tag can facilitate specific pulldown of interaction partners of the N-terminal portion of the protein, as demonstrated in studies with related photosystem proteins.

How do environmental conditions affect psaF expression and function in Mastigocladus laminosus?

As a thermophilic cyanobacterium inhabiting hot springs, Mastigocladus laminosus has evolved specific regulatory mechanisms for psaF expression and function that respond to environmental variables. Temperature fluctuations represent a primary environmental factor, with optimal psaF expression and functionality likely occurring at temperatures between 45-55°C, reflecting the organism's thermophilic nature. Light quality and intensity also significantly modulate psaF expression patterns, with potential upregulation under high light conditions to enhance electron transport capacity. Nutrient availability, particularly iron limitation, may affect the stoichiometry of PSI components including psaF, as iron is essential for the function of the electron transport chain. Additionally, the proximity of psaF to genes involved in far-red light acclimation in some cyanobacteria suggests potential responsiveness to light spectrum variations. These environmental adaptations likely contribute to the unique properties of PSI in Mastigocladus laminosus, enabling efficient photosynthesis in extreme environments while maintaining the core functionality of the photosystem.

What is the relationship between PSI oligomeric states and physiological adaptation in cyanobacteria?

The relationship between PSI oligomeric states and physiological adaptation in cyanobacteria represents a sophisticated evolutionary strategy for optimizing photosynthetic performance under diverse environmental conditions. Research on heterocyst-forming cyanobacteria (HCR) has revealed a strong correlation between tetrameric PSI structures and their specialized lifestyles. The tetrameric arrangement may provide specific advantages for nitrogen fixation by optimizing energy distribution between vegetative cells and heterocysts. The observation that "most heterocyst-forming cyanobacteria have tetrameric PSI" suggests this oligomeric state confers selective advantages in environments where nitrogen limitation occurs frequently. In contrast, most non-heterocystous cyanobacteria predominantly form trimeric PSI complexes, while some marine species maintain primarily monomeric PSI. These different oligomeric states likely reflect adaptations to specific light environments, nutrient availability, and metabolic requirements. The structural plasticity of PSI, facilitated by the specific properties of subunits like psaF and PsaL, allows cyanobacteria to fine-tune their photosynthetic apparatus in response to environmental challenges, representing a key aspect of their evolutionary success across diverse ecological niches.

How can recombinant psaF be used for biophysical studies of photosynthetic electron transport?

Recombinant psaF from Mastigocladus laminosus offers unique opportunities for biophysical investigations of photosynthetic electron transport mechanisms. When expressed with appropriate purification tags and reconstituted into membrane systems or attached to electrode surfaces, it can serve as a platform for studying electron transfer kinetics under controlled conditions. Time-resolved spectroscopy techniques, including ultrafast transient absorption and electron paramagnetic resonance (EPR), can track electron movement through the protein with precision down to the picosecond timescale. Surface-enhanced resonance Raman spectroscopy (SERRS) can provide vibrational information about the interaction between psaF and electron donors like cytochrome c. For quantitative binding studies, isothermal titration calorimetry (ITC) and microscale thermophoresis (MST) can determine the thermodynamic parameters of cytochrome binding to psaF under various solution conditions, elucidating how factors like ionic strength and pH affect these interactions. These approaches can specifically address how the thermophilic nature of Mastigocladus laminosus psaF influences electron transfer properties compared to mesophilic counterparts, providing insights into temperature adaptation of photosynthetic electron transport systems.

What are the challenges and solutions in expressing functional recombinant psaF?

Expressing functional recombinant psaF from Mastigocladus laminosus presents several technical challenges that require specific solutions:

  • Membrane protein solubility: As a transmembrane protein, psaF tends to aggregate when expressed in heterologous systems. This can be addressed by using fusion partners like maltose-binding protein (MBP) or SUMO to enhance solubility, coupled with careful optimization of detergent types (DDM, LDAO, or Fos-choline-12) and concentrations during purification.

  • Proper folding: The thermophilic nature of Mastigocladus laminosus psaF may lead to folding issues at lower temperatures used for heterologous expression. Expression in systems that tolerate higher temperatures (like Thermus thermophilus) or use of heat shock protocols during expression can improve folding.

  • Post-translational modifications: If specific modifications are required for function, expression systems capable of introducing these modifications or in vitro modification approaches must be employed.

  • Functional reconstitution: For activity studies, purified psaF must be reconstituted into appropriate membrane environments. Liposomes with defined lipid compositions or nanodiscs can provide suitable membrane environments for functional studies.

  • Verification of structure: Circular dichroism spectroscopy, limited proteolysis, and binding assays with natural partners (like cytochromes) should be used to confirm that the recombinant protein maintains native-like structure and function.

By systematically addressing these challenges, researchers can obtain functional recombinant psaF suitable for detailed mechanistic and structural studies.

How can genomic editing techniques be applied to study psaF function in vivo?

Modern genomic editing techniques offer powerful approaches for studying psaF function directly in Mastigocladus laminosus or model cyanobacteria. CRISPR-Cas9 systems adapted for cyanobacterial editing can create precise modifications, from single nucleotide changes to complete gene deletions. For targeting psaF, specific guide RNAs can be designed based on the gene sequence, along with appropriate repair templates for introducing desired modifications. When creating knockout mutants, amplification of approximately 600 bp upstream and downstream of the psaF gene locus allows for homologous recombination-based replacement with selectable markers. For complementation studies, the psaF gene can be amplified with primers containing appropriate restriction sites (such as BamHI and XhoI) for cloning into expression vectors under control of native or constitutive promoters. These constructs can be introduced into cyanobacteria through natural transformation, electroporation, or conjugation methods depending on the species. For verification of genomic modifications, a combination of PCR screening, sequencing, and protein expression analysis should be employed. The resulting mutant strains can then be characterized through growth analyses, photosynthetic activity measurements, and detailed biochemical characterization of PSI complexes to determine how specific modifications affect psaF function in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.