Recombinant Mastigocladus laminosus Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

While direct data on M. laminosus PsbA recombinant production is limited, parallel studies on homologous systems provide insights:

  • Expression Systems: Cyanobacterial PsbA homologs are typically expressed in E. coli with N-terminal His tags for purification .

  • Structural Studies: Recombinant PsbA enables crystallographic analysis of QB-site interactions, critical for understanding herbicide resistance and electron transport .

  • Bioelectrochemical Applications: PSII complexes containing recombinant PsbA from M. laminosus have been integrated into photobiofuel cells, achieving photocurrent densities of ~3 μA/cm² using quinone-mediated electron transfer to gold electrodes .

Functional Insights from Related Systems

Research on Synechocystis and Anabaena PsbA homologs highlights conserved mechanisms:

  • QB-Site Plasticity: The QB pocket undergoes conformational changes during plastoquinone reduction, influenced by interactions with the cytochrome b₆f complex .

  • Linker Protein Interactions: ApcG/ApcI linker proteins regulate energy transfer from phycobilisomes to PSII, indirectly stabilizing PsbA function under high-light conditions .

  • Photoinhibition Resistance: Thermophilic PsbA variants exhibit enhanced resilience to photodamage compared to mesophilic counterparts, a trait leveraged in bioengineering studies .

Research Challenges and Future Directions

  • Heterologous Expression: Achieving functional folding of PsbA in E. coli requires optimized redox conditions to assemble the Mn₄CaO₅ cluster .

  • Cryo-EM Advancements: Recent sub-3Å structures of cyanobacterial PSII (e.g., Synechocystis) provide templates for modeling M. laminosus PsbA dynamics .

  • Biotechnological Potential: Engineered PsbA variants could improve photosynthetic efficiency or enable scalable biohybrid energy systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Mastigocladus laminosus (Fischerella sp.)
Target Names
psbA
Target Protein Sequence
MTTTLRRGETGSLWDRFCDWITSTNNRIYVGWFGVLMIPTLLAATICFVIAFIAAPPVDI DGIREPVSGSLLYGNNIITGAVVPTSNAIGLHFYPIWEALDEWLYNGGPYELIVFHFLIG IFCWLGRQWELSYRLGMRPWICVAYSAPVAAATSVFLIYPIGQGSFSDGMPLGITGTFNF MLVFQAEHNILMHPFHQLGVAGVFGGSLFCAMHGSLVTSSLVRETTETESQNYGYKFGQE QETYSIVAAHGYFGRLIWQYASFNNSRSLHFFLAAWPVVCIWFTALGISTMAFNLNGFNF NQSILDSQGRVVNTWADILNRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently utilized for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Mastigocladus laminosus and why is its psbA protein significant for photosynthesis research?

Mastigocladus laminosus is a thermophilic, heterocyst-forming cyanobacterium belonging to the order Stigonematales that is found in thermal areas throughout the world. Research has shown that populations are typically genetically differentiated on local geographic scales, suggesting the existence of dispersal barriers . This differentiation is corroborated by evidence for genetic isolation by distance.

The psbA gene encodes the Photosystem Q (B) protein (also known as Photosystem II protein D1), which functions as one of the two reaction center proteins of photosystem II. This protein is crucial for photosynthesis as it:

  • Forms part of the heterodimer (with psbB) that binds P680, the primary electron donor of photosystem II

  • Provides most of the ligands for the Mn-cluster of the oxygen-evolving complex

  • Catalyzes the water-splitting reaction: 2 H2O + 2 plastoquinone + 4 light = O2 + 2 plastoquinol

  • Contains the binding site for various herbicides that block electron transport

The significance of studying M. laminosus psbA stems from its thermostability characteristics and evolutionary history. Genealogical studies suggest that a significant amount of the extant global diversity of M. laminosus can be traced back to a common ancestor associated with the western North American hot spot currently located below Yellowstone National Park .

How does the psbA gene differ between Mastigocladus laminosus and other photosynthetic organisms?

The psbA gene in M. laminosus exhibits several distinct characteristics when compared to other photosynthetic organisms:

  • Geographic differentiation: Unlike many other cyanobacteria, M. laminosus shows significant genetic differentiation between populations even at relatively short distances. For example, two Yellowstone National Park populations separated by only 50 km were found to be genetically differentiated with undetectable migration between them .

  • Recombination rates: M. laminosus exhibits intragenic recombination rates comparable to those of pathogenic bacteria known for their capacity to exchange DNA, indicating that genetic exchange has played an important role in generating novel variation during M. laminosus diversification .

  • Thermal adaptation: Different lineages of M. laminosus show variation in thermal performance, reflecting adaptation to specific thermal environments .

  • Codon usage patterns: While plant psbA genes have been shown to have atypical codon usage patterns that have been decreasing during angiosperm evolution , M. laminosus codon usage may show distinct patterns related to its thermophilic lifestyle.

  • Selective constraints: Selection has constrained protein changes at loci involved in the assimilation of both dinitrogen and nitrate in M. laminosus, suggesting the historic use of both nitrogen sources in this heterocystous cyanobacterium .

What are the structural features of the psbA protein that contribute to its function?

The psbA protein (Photosystem Q (B) protein) has several important structural features that are essential for its function in photosynthesis:

  • Membrane topology: It is a multi-pass thylakoid membrane protein with multiple transmembrane spans that anchor it within the membrane .

  • Functional domains:

    • The protein contains the QB binding pocket, which is the site for plastoquinone reduction and electron transport

    • It provides coordination sites for cofactors including chlorophylls, pheophytin, and a non-heme iron (shared with the psbB subunit)

    • The protein contributes most of the ligands for the manganese cluster of the oxygen-evolving complex

  • Molecular characteristics:

    • The mature protein consists of positions 2-344 with a calculated molecular weight of 38,937 Da

    • Contains specific regions that are targets for herbicides such as atrazine, BNT, diuron or ioxynil, which block electron transport by binding to the Q(B) site

  • Thermal stability:

    • As M. laminosus is a thermophilic organism, its psbA protein likely contains structural adaptations that enhance thermal stability compared to mesophilic counterparts

    • These may include additional salt bridges, increased hydrophobic packing, and reduced flexibility in certain regions

  • Binding partners:

    • Forms a heterodimer with psbB to create the reaction center of photosystem II

    • Interacts with other photosystem II components to form the functional complex

What expression systems are optimal for producing functional recombinant Mastigocladus laminosus psbA protein?

The expression of functional recombinant M. laminosus psbA protein presents several challenges due to its membrane-associated nature and complex cofactor requirements. Several expression systems can be considered, each with distinct advantages:

  • E. coli-based expression systems:

    • Specialized strains designed for membrane protein expression (C41/C43) yield better results

    • Cold-shock promoters for low-temperature expression (16-20°C) reduce inclusion body formation

    • Fusion with solubility-enhancing tags such as MBP or GST increases expression levels

    • Co-expression with chaperones can improve folding

  • Cyanobacterial expression systems:

    • Provide the native-like environment with photosynthetic machinery

    • Synechocystis PCC 6803 or Thermosynechococcus elongatus are suitable hosts

    • Integration into neutral sites in the genome with inducible promoters

    • Allow proper insertion of cofactors and assembly with other PSII components

  • Cell-free expression systems:

    • Allow direct incorporation into liposomes or nanodiscs during synthesis

    • Can be supplemented with necessary cofactors and lipids

    • Avoid toxicity issues that may occur in live cells

    • Enable rapid screening of different constructs

Expression of M. laminosus psbA can be optimized by:

  • Using codon optimization for the expression host

  • Including a cleavable N-terminal His-tag for purification

  • Adding stabilizing agents such as glycerol (10-20%) and specific lipids

  • Maintaining reducing conditions with β-mercaptoethanol or DTT

  • Controlling light exposure during expression and purification

For structural studies, E. coli expression systems often provide the highest yields, while for functional studies, cyanobacterial expression systems may better preserve native activity.

What methods are most effective for assessing the proper folding and function of recombinant psbA protein?

Assessing the proper folding and function of recombinant psbA protein requires a multi-faceted approach combining structural and functional analyses:

  • Spectroscopic methods for structural assessment:

    • Circular dichroism (CD) spectroscopy: Far-UV CD (190-250 nm) for secondary structure content and thermal stability profiles

    • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence and chlorophyll fluorescence to assess tertiary structure and pigment incorporation

    • FTIR spectroscopy: Amide I band analysis for secondary structure determination

  • Functional assays:

    • Oxygen evolution: Using Clark-type electrodes to measure water-splitting activity

    • Electron transport: Artificial electron acceptor assays (DCPIP reduction)

    • Binding assays: Herbicide binding studies to assess QB pocket integrity

    • Photochemical activity: Chlorophyll fluorescence induction and quenching analysis

  • Structural integrity assessment:

    • Limited proteolysis: Comparison of digestion patterns between recombinant and native protein

    • Thermal stability assays: Differential scanning calorimetry and thermofluor assays

    • Size-exclusion chromatography: Assessment of oligomeric state and aggregation

  • Cofactor analysis:

    • Pigment extraction and HPLC analysis: Quantification of bound chlorophyll and pheophytin

    • Metal content analysis: ICP-MS for determination of bound metals

    • EPR spectroscopy: Characterization of paramagnetic metal centers

MethodInformation ObtainedSample RequirementsLimitations
Far-UV CDSecondary structure content0.1-0.5 mg/mL proteinInterference from some detergents
Oxygen evolutionFunctional water-splittingReconstituted membranesRequires proper assembly of oxygen-evolving complex
Herbicide bindingQB pocket integrity1-10 μM proteinIndirect measure of function
Thermal stabilityProtein unfolding transitionMicrogram quantitiesMay not reflect functional loss

For M. laminosus psbA, comparing thermal stability profiles with the native protein is particularly important given its thermophilic nature, as proper folding should result in enhanced thermostability compared to mesophilic counterparts.

How should researchers design experiments to compare the thermal stability of psbA proteins from different Mastigocladus laminosus geographic isolates?

Designing experiments to compare the thermal stability of psbA proteins from different M. laminosus geographic isolates requires a systematic approach that combines molecular, biophysical, and functional analyses:

  • Sample preparation:

    • Collect M. laminosus from geographically distinct thermal habitats

    • Document environmental parameters at collection sites (temperature, pH, mineral content)

    • Sequence psbA genes from each isolate to identify variations

    • Express recombinant psbA from each isolate using identical expression systems to eliminate method-based variations

  • Thermal stability assessment methods:

    • Differential scanning calorimetry (DSC): Direct measurement of protein unfolding transitions and determination of melting temperature (Tm)

    • Circular dichroism (CD) thermal melts: Monitor secondary structure changes during thermal denaturation

    • Intrinsic fluorescence spectroscopy: Track tertiary structure changes at increasing temperatures

    • Thermofluor (differential scanning fluorimetry): Use of hydrophobic dyes to detect thermal unfolding

  • Functional thermal stability assays:

    • Temperature-dependent oxygen evolution: Measure activity at increasing temperatures to determine thermal optima

    • Electron transport activity: Artificial electron acceptor reduction rates at varying temperatures

    • Arrhenius plot analysis: Determine activation energies for different isolates

  • Structural stability comparison:

    • Limited proteolysis at varying temperatures: Identify thermolabile regions

    • Hydrogen-deuterium exchange mass spectrometry: Measure structural dynamics at different temperatures

    • Thermal aggregation assays: Monitor aggregation onset temperature differences

  • Data analysis:

    • Correlate thermal stability parameters with habitat temperature

    • Identify sequence variations associated with thermal stability differences

    • Compare multiple stability parameters across techniques for comprehensive assessment

The lineage-specific differences in thermal performance that have been observed in M. laminosus make this type of analysis particularly valuable for understanding the molecular basis of thermal adaptation in photosynthetic machinery.

What are the best approaches for purifying recombinant psbA protein while maintaining its functional integrity?

Purifying recombinant psbA protein while preserving its functional integrity requires careful attention to buffer conditions, detergent selection, and handling procedures. A comprehensive purification protocol should include:

  • Cell disruption and membrane preparation:

    • Harvest cells by centrifugation (6,000 × g, 10 min, 4°C)

    • Resuspend in buffer containing protease inhibitors, glycerol, and divalent cations (Mg2+, Ca2+)

    • Disrupt cells using appropriate method (French pressure cell, sonication, or bead-beating)

    • Collect membranes by ultracentrifugation (150,000 × g, 1 h, 4°C)

  • Membrane protein solubilization:

    • Select appropriate detergent based on downstream applications:

      • n-dodecyl-β-D-maltoside (DDM): 1% (w/v) for general use

      • Digitonin: 1-2% (w/v) for gentler extraction, better for structural studies

      • Lauryl maltose neopentyl glycol (LMNG): Enhanced stability for longer-term storage

    • Incubate with gentle agitation (1 h, 4°C)

    • Remove insoluble material by ultracentrifugation

  • Affinity chromatography:

    • For His-tagged protein, use Ni-NTA resin equilibrated with low imidazole (10 mM)

    • Include detergent (0.03% DDM) in all purification buffers

    • Wash stringently to remove contaminants

    • Elute with 250 mM imidazole

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates and assess homogeneity

    • Ion exchange chromatography for further purification if needed

  • Critical considerations for maintaining function:

    • Temperature control: Maintain 4°C throughout purification

    • Light exposure: Minimize exposure to light; work under green light when possible

    • Reducing conditions: Include 1-5 mM β-mercaptoethanol or DTT in all buffers

    • Stabilizing additives: Glycerol (10-20

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.