Recombinant Maxomys bartelsii Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Maxomys bartelsii (Bartels's spiny rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLYYGQCSEICGSNHSFMPIVLEMVPLKNFENWSASMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, which powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, consisting of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Maxomys bartelsii MT-CO2?

Maxomys bartelsii MT-CO2 is a core subunit of mitochondrial Cytochrome c oxidase containing a dual core CuA active site. Based on comparative analysis with other mammalian species, the MT-CO2 likely contains an open reading frame of approximately 680-690 bp encoding 225-230 amino acid residues. The protein plays a significant role in cellular respiration, catalyzing the oxidation of cytochrome c and facilitating electron transfer in the respiratory chain. Structurally, the protein contains copper-binding motifs essential for its catalytic function and likely has a molecular mass of approximately 26 kDa with a pI value around 6.3-6.5 .

What phylogenetic insights can be gained from studying MT-CO2 in Maxomys bartelsii?

Phylogenetic analysis of MT-CO2 can provide valuable information about the evolutionary relationships between Maxomys bartelsii and other rodent species. Multiple sequence alignment typically reveals high sequence conservation in functional domains, particularly in copper-binding regions. When constructing phylogenetic trees, researchers should employ maximum likelihood methods with appropriate evolutionary models. These analyses can help determine divergence times and evolutionary patterns in Muridae, particularly within the Maxomys genus native to Southeast Asian forests such as those found in the Bengawan Solo River Basin in Java, Indonesia .

What expression systems are most effective for producing functional recombinant MT-CO2?

For successful expression of recombinant MT-CO2, E. coli Transetta (DE3) expression systems using vectors such as pET-32a have proven effective for similar proteins. The methodology should include:

  • Subcloning the full-length cDNA into the expression vector

  • Transformation into the E. coli expression strain

  • Induction with isopropyl β-d-thiogalactopyranoside (IPTG) at concentrations between 0.1-1.0 mM

  • Cultivation at lower temperatures (16-25°C) to enhance protein solubility

  • Cell lysis under native conditions to preserve protein structure

This approach has been successful with recombinant COXII from other species, yielding functional protein with preserved enzymatic activity .

What purification strategies yield the highest purity and activity for recombinant MT-CO2?

Optimal purification of recombinant MT-CO2 typically involves:

  • Affinity chromatography using Ni²⁺-NTA agarose for His-tagged protein

  • Careful washing to remove non-specific binding proteins

  • Elution with an imidazole gradient (50-250 mM)

  • Buffer exchange to remove imidazole

  • Secondary purification steps such as ion exchange chromatography

This methodology has been shown to yield recombinant COXII with concentrations around 50 μg/mL and purity suitable for functional studies .

Purification StepBuffer CompositionYield (%)Purity (%)
Crude Extract50 mM Tris-HCl, pH 8.0, 300 mM NaCl10015-20
Ni²⁺-NTA Affinity50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 10-250 mM imidazole60-7085-90
Ion Exchange20 mM HEPES, pH 7.5, 50-500 mM NaCl gradient40-50>95

How can the enzymatic activity of purified recombinant MT-CO2 be accurately measured?

The enzymatic activity of recombinant MT-CO2 can be measured using UV-spectrophotometry to monitor the oxidation of reduced cytochrome c. The assay typically involves:

  • Preparing reduced cytochrome c substrate

  • Monitoring absorbance changes at 550 nm (characteristic peak for reduced cytochrome c)

  • Calculating activity based on the rate of absorbance decrease

  • Including appropriate controls with enzyme inhibitors

Additionally, infrared spectrometry can be used to analyze catalytic properties and substrate interactions. These analytical approaches can detect functional changes in response to environmental factors or chemical compounds such as allyl isothiocyanate (AITC) .

What analytical methods can distinguish between properly folded and misfolded recombinant MT-CO2?

Multiple analytical techniques can assess proper folding:

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure

  • Tryptophan fluorescence spectroscopy to assess tertiary structure

  • Size exclusion chromatography to detect aggregation

  • Limited proteolysis to probe structural integrity

  • Activity assays to confirm functional conformation

Properly folded MT-CO2 will display characteristic spectral properties, resist limited proteolysis, and demonstrate catalytic activity toward cytochrome c oxidation.

How can molecular docking be applied to study interactions between MT-CO2 and potential inhibitors or substrates?

Molecular docking provides valuable insights into MT-CO2 interactions with substrates and inhibitors. The methodology includes:

  • Generating a three-dimensional model of MT-CO2 (via homology modeling if crystal structure is unavailable)

  • Preparing ligand structures with appropriate protonation states

  • Defining the binding site based on known functional residues

  • Conducting docking simulations with flexible side chains

  • Analyzing binding poses and interaction energies

Studies with similar proteins have demonstrated that molecular docking can identify specific interaction sites, such as the hydrogen bond formation between sulfur atoms in compounds like AITC and specific amino acid residues (e.g., Leu-31) in the protein structure .

What techniques are most effective for investigating MT-CO2 involvement in mitochondrial dysfunction?

For investigating MT-CO2's role in mitochondrial dysfunction:

  • Site-directed mutagenesis of conserved residues to mimic pathogenic mutations

  • Oxygen consumption measurements in reconstituted systems

  • ROS production assays to link structural changes to oxidative stress

  • Mitochondrial membrane potential measurements using fluorescent probes

  • Comparison of wild-type and mutant MT-CO2 effects on cellular bioenergetics

These approaches can help elucidate how structural alterations in MT-CO2 contribute to respiratory chain deficiencies.

How can recombinant MT-CO2 be used to study environmental adaptations in Maxomys bartelsii populations?

The study of MT-CO2 can provide insights into environmental adaptations through:

  • Comparative sequence analysis of MT-CO2 from Maxomys bartelsii populations across different forest ecosystems

  • Functional characterization of variants to identify adaptations to specific environmental conditions

  • Correlation of enzymatic efficiency with habitat parameters (altitude, temperature, humidity)

  • Assessment of selective pressures through molecular evolution analyses

This approach is particularly relevant for understanding physiological adaptations of Maxomys bartelsii to varying forest conditions in ecosystems like the Bengawan Solo River Basin in Java, Indonesia .

What role might MT-CO2 play in understanding the metabolic responses of Maxomys bartelsii to environmental CO2 fluctuations?

MT-CO2's role in cellular respiration makes it an important protein for studying metabolic responses to environmental CO2 changes:

  • Expression analysis of MT-CO2 under varying CO2 concentrations

  • Enzymatic activity comparisons across CO2 gradients

  • Structural adaptations that might enhance function under high CO2 conditions

  • Correlation with other respiratory proteins to identify coordinated responses

These investigations may reveal how Maxomys bartelsii adapts to changing carbon dioxide levels in their forest habitats, particularly relevant in the context of increasing global CO2 emissions .

What are the most common challenges in obtaining functionally active recombinant MT-CO2, and how can they be addressed?

Common challenges and solutions include:

ChallengePotential Solutions
Poor expressionOptimize codon usage, lower induction temperature (16-20°C), try different E. coli strains
Inclusion body formationUse solubility tags (SUMO, MBP), reduce IPTG concentration, co-express with chaperones
Loss of copper cofactorsInclude copper ions in purification buffers, avoid strong chelating agents
Proteolytic degradationAdd protease inhibitors, reduce purification time, maintain low temperature
Low enzymatic activityEnsure proper refolding, reconstitute with copper ions, optimize buffer conditions

How can researchers distinguish between changes in MT-CO2 activity due to experimental artifacts versus genuine biological effects?

To distinguish artifacts from biological effects:

  • Include multiple appropriate controls (positive, negative, buffer-only)

  • Perform activity assays under varying conditions to identify artifacts

  • Use complementary assay methods to confirm findings

  • Validate with native enzyme preparations when possible

  • Compare with published data for related proteins

  • Conduct statistical analyses to determine significance of observed changes

How might CRISPR/Cas9 technology be applied to study MT-CO2 function in vivo?

CRISPR/Cas9 applications for MT-CO2 research include:

  • Introducing tagged versions of MT-CO2 for in vivo tracking

  • Creating specific mutations to study structure-function relationships

  • Developing knockout/knockdown models to assess physiological impacts

  • Implementing conditional expression systems to study temporal regulation

  • Creating reporter systems to monitor MT-CO2 expression under various conditions

These approaches can provide insights into MT-CO2's role in cellular physiology that cannot be obtained through in vitro studies alone.

What are the prospects for using cryo-EM to resolve the structure of Maxomys bartelsii MT-CO2 within the complete cytochrome c oxidase complex?

Cryo-EM offers significant advantages for structural studies:

  • Sample preparation without crystallization, preserving native conformations

  • Visualization of the complete cytochrome c oxidase complex (>200 kDa)

  • Potential to capture different functional states

  • Ability to resolve interactions between MT-CO2 and other subunits

  • Identification of species-specific structural features

Recent advances in cryo-EM have enabled resolutions below 3Å for membrane protein complexes, making this a viable approach for MT-CO2 structural studies.

What methodologies are most effective for comparing MT-CO2 from Maxomys bartelsii with orthologous proteins from other rodent species?

For effective comparative studies:

  • Multiple sequence alignment using MUSCLE or MAFFT algorithms

  • Conservation analysis focusing on functional domains

  • Selection pressure analysis (dN/dS ratios) across protein regions

  • Homology modeling to compare predicted structures

  • Ancestral sequence reconstruction to trace evolutionary changes

These approaches can reveal how MT-CO2 has evolved in Maxomys bartelsii compared to related species and identify unique adaptations.

How can researchers integrate MT-CO2 data into broader studies of mitochondrial evolution in endemic Indonesian mammals?

Integration strategies include:

  • Coordinated analysis of multiple mitochondrial genes, including MT-CO2

  • Construction of species trees using concatenated mitochondrial sequences

  • Biogeographic analysis correlating genetic patterns with geological history

  • Comparative analysis of selection patterns across Indonesian mammal lineages

  • Integration with ecological data to understand adaptive evolution

Such integrated approaches can place MT-CO2 findings within the broader context of mitochondrial evolution in Indonesian mammals like Maxomys bartelsii that are found in specific forest ecosystems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.