Recombinant Maxomys surifer Cytochrome c oxidase subunit 2 (MT-CO2)

What is Maxomys surifer Cytochrome c oxidase subunit 2 and what is its biological significance?

Cytochrome c oxidase subunit 2 (MT-CO2) from Maxomys surifer (Red spiny rat) is a critical protein component of the cellular respiratory chain. This highly conserved protein is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is crucial for ATP production during cellular respiration . MT-CO2 in Maxomys surifer is encoded by the mitochondrial genome and contains 227 amino acids . The biological significance of this protein lies in its essential role in energy production and its utility in phylogenetic studies of murine rodents due to its sequence conservation and variability patterns.

How is the amino acid sequence of Maxomys surifer MT-CO2 characterized?

The full amino acid sequence of Maxomys surifer MT-CO2 is: MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISTLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAVILILIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI . This sequence is notable for conserved regions involved in electron transfer and interaction with other respiratory chain components. Researchers should analyze sequence alignments with other species to identify key variable regions that might be useful for phylogenetic studies.

What purification methods are most effective for recombinant MT-CO2 from expression systems?

For effective purification of recombinant MT-CO2, affinity chromatography using the His-tag system is typically most effective. Based on established protocols for similar proteins, researchers should:

• Start with cell lysis using a bead beater or sonication

• Clarify lysate by centrifugation at 12,000 × g for 20 minutes

• Bind the 6x-His-tagged protein to Ni-NTA or similar resin

• Wash extensively with buffer containing low imidazole concentration

• Elute with buffer containing high imidazole concentration (250-500 mM)

For space-constrained applications, batch resin methods have been demonstrated as effective with automated systems utilizing peristaltic pumps and pinch valves . Size exclusion chromatography may be used as a polishing step to achieve higher purity when needed for specific applications.

How do phylogenetic analyses of MT-CO2 inform our understanding of Maxomys evolutionary history?

Phylogenetic analyses of MT-CO2 and related genes have revealed significant insights into Maxomys evolutionary history. Studies utilizing 480 base pairs of related Cytochrome Oxidase I (COI) gene have consistently identified eight distinct groups within the Maxomys genus with high bootstrap support values (82-100% NJ, 64-100% MP, 66-100% ML) .

For MT-CO2 specifically, researchers should note:

• Interpopulation divergence can reach nearly 20% at nucleotide level

• Multiple phylogenetic lineages exist within what was previously considered a single species

• Northern Vietnamese populations show sufficient genetic and morphological distinction to merit subspecies status (M. s. tonkinensis)

When conducting MT-CO2 phylogenetic analyses, researchers should employ multiple tree-building methods (Neighbor-joining, Maximum parsimony, Maximum likelihood, and Bayesian analysis) to ensure robust results.

What protocols should be followed to analyze selective pressures acting on MT-CO2 in Maxomys populations?

To analyze selective pressures acting on MT-CO2 in Maxomys populations, researchers should:

• Sequence full-length MT-CO2 from multiple populations across the geographic range

• Calculate the ratio of nonsynonymous to synonymous substitutions (ω) using maximum likelihood models of codon substitution

• Apply site-specific models to identify codons under positive selection

• Implement branch-site maximum likelihood models to detect lineage-specific selection

• Validate findings with functional assays measuring electron transfer efficiency

Studies of similar proteins have shown that despite being highly conserved, approximately 4% of codons may evolve under relaxed selective constraint (ω = 1), while most sites remain under strong purifying selection (ω << 1) . Researchers should pay particular attention to sites that interact with nuclear-encoded proteins as these may experience compensatory selection.

How can researchers effectively design experiments to study the functional consequences of MT-CO2 variation across Maxomys populations?

To study functional consequences of MT-CO2 variation across Maxomys populations, researchers should design experiments that:

• Express recombinant MT-CO2 variants from different populations

• Reconstitute cytochrome c oxidase complexes in vitro

• Measure electron transfer rates and efficiency under varying temperature conditions

• Assess protein stability through thermal denaturation assays

• Create hybrid complexes with nuclear-encoded components from different populations to test co-adaptation hypotheses

Previous studies with other organisms have shown functional and fitness consequences among interpopulation hybrids that may result from incompatibilities between mitochondrial and nuclear-encoded components of the respiratory chain . Researchers should include control experiments with conserved MT-CO2 from other species to establish baseline expectations for function.

What expression systems are optimal for producing functional recombinant Maxomys surifer MT-CO2?

While no specific expression system for Maxomys surifer MT-CO2 is detailed in the search results, based on similar proteins, the following approach is recommended:

For initial studies, E. coli expression with a combination of molecular chaperones (GroEL/ES) is suggested to improve folding of this membrane-associated protein. Codon optimization based on the target expression system is critical for optimal expression. For functional studies, consider using a specialized E. coli strain with enhanced ability to form disulfide bonds and express membrane proteins.

How should researchers approach the analysis of nonsynonymous substitutions in MT-CO2 sequences from different Maxomys populations?

To effectively analyze nonsynonymous substitutions in MT-CO2:

• First, conduct comprehensive sampling across the geographic range of Maxomys surifer

• Sequence the complete MT-CO2 gene from multiple individuals per population

• Align sequences and identify nonsynonymous substitutions

• Map substitutions onto predicted protein structure to identify functional domains affected

• Employ evolutionary models in software like PAML to estimate ω values site-by-site

• Conduct sliding window analysis to identify regions with clusters of nonsynonymous changes

• Compare patterns with those from related species to distinguish species-specific from genus-wide patterns

Previous studies of similar proteins have identified up to 38 nonsynonymous substitutions between populations . Focus particularly on substitutions in regions interacting with nuclear-encoded components, as these may reflect co-evolutionary processes.

What approaches can be used to investigate the interaction between MT-CO2 and nuclear-encoded components of the respiratory chain?

To investigate interactions between MT-CO2 and nuclear-encoded respiratory chain components:

• Perform co-immunoprecipitation assays with tagged recombinant proteins

• Utilize yeast two-hybrid or bacterial two-hybrid systems for initial screening

• Apply proximity labeling techniques (BioID or APEX) in cellular systems

• Conduct surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for quantitative binding measurements

• Create genetic hybrids between populations with divergent MT-CO2 sequences to assess compatibility

Given the high degree of interaction between MT-CO2 and nuclear-encoded subunits of COX and cytochrome c (CYC), researchers should pay particular attention to potential compensatory evolution . Design experiments that can specifically test whether nuclear-encoded components have evolved to maintain functional compatibility with rapidly evolving mitochondrial components.

How do researchers address contradictions in phylogenetic data when analyzing MT-CO2 sequences?

When addressing contradictions in phylogenetic data from MT-CO2 sequences:

• Compare results from multiple gene regions (e.g., cytochrome b, COI, and nuclear genes like IRBP)

• Apply different tree-building algorithms and compare results

• Conduct statistical tests such as Shimodaira-Hasegawa or approximately unbiased (AU) tests to evaluate alternative topologies

• Consider incomplete lineage sorting as a potential explanation for discordance

• Assess the potential for introgression or hybridization between populations

Research has shown that different genes may support different phylogenetic relationships, as seen in Maxomys surifer populations where seven major phylogenetic clusters are apparent in mitochondrial genes, but nuclear genes may support different groupings . When contradictions arise, integrate morphological data as an independent line of evidence.

What statistical approaches are most appropriate for analyzing selection patterns in MT-CO2 across Maxomys populations?

For statistical analysis of selection patterns in MT-CO2:

• Employ likelihood ratio tests between nested models (e.g., M1a vs. M2a, M7 vs. M8) in PAML to identify sites under positive selection

• Use Bayesian approaches to calculate posterior probabilities for site-specific selection

• Apply branch-site tests to identify lineage-specific selection events

• Conduct McDonald-Kreitman tests to compare polymorphism and divergence

• Implement codon-based analyses like MEME to detect episodic diversifying selection

Researchers should be cautious about false positives and employ multiple testing corrections. Previous studies have identified approximately 4% of sites in related COII genes evolving under relaxed selective constraint, with specific sites potentially under positive selection in certain lineages .

How can researchers effectively correlate MT-CO2 sequence variations with functional differences in oxidative phosphorylation efficiency?

To correlate MT-CO2 sequence variations with functional differences:

• Express recombinant variants in a consistent cellular background

• Measure oxygen consumption rates using high-resolution respirometry

• Assess membrane potential generation using potentiometric dyes

• Quantify ATP production under standardized conditions

• Conduct thermal stress tests to evaluate stability differences

• Measure reactive oxygen species production as an indicator of electron leakage

These measurements should be performed at multiple temperatures to detect potential thermal adaptations. Researchers should develop robust statistical models that account for the hierarchical nature of the data (populations nested within geographic regions) and include appropriate covariates like body mass or metabolic rate.

What are the potential applications of recombinant MT-CO2 in biomanufacturing systems?

While MT-CO2 itself hasn't been specifically studied for biomanufacturing, insights from similar recombinant protein applications suggest:

• Potential use in enzymatic carbon capture systems, similar to carbonic anhydrase applications

• Integration into bioelectronic devices for sensing or energy production

• Development of biomimetic catalysts based on the electron transfer capabilities

• Use as a model system for studying membrane protein incorporation into artificial membranes

Future research should assess the stability and activity of recombinant MT-CO2 under various conditions relevant to biomanufacturing, such as temperature cycling, exposure to different solvents, and long-term storage. Integration with microfluidic systems could enable novel applications in biosensing.

How might climate change impact the evolution of MT-CO2 in Maxomys populations?

Climate change could influence MT-CO2 evolution through several mechanisms:

• Increased environmental temperatures may drive selection for variants with higher thermal stability

• Range shifts could create new contact zones between previously isolated populations, potentially leading to adaptive introgression

• Changes in metabolic demands due to altered resource availability might select for variants with different catalytic efficiencies

Research indicates that climate impacts on carbon cycles may have significant mortality consequences , suggesting potential parallel effects on the evolution of proteins involved in cellular respiration. Researchers should establish long-term monitoring of genetic variation in MT-CO2 across Maxomys populations experiencing different rates of climate change.

What novel methodologies could improve our understanding of the structure-function relationship in MT-CO2?

Emerging technologies that could advance MT-CO2 research include:

• Cryo-electron microscopy to determine high-resolution structures of the intact cytochrome c oxidase complex containing MT-CO2

• AlphaFold2 or similar AI-based structure prediction tools to model effects of sequence variations

• Nanoscale respirometry to measure function of individual enzyme complexes

• In situ labeling techniques to track assembly and turnover in living cells

• CRISPR-based approaches to introduce specific MT-CO2 variants into model systems

These technologies could help resolve outstanding questions about how specific amino acid changes affect electron transfer efficiency, proton pumping, and protein-protein interactions in the cytochrome c oxidase complex .