Recombinant Mechanosensory protein 2 (mec-2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant MEC-2 is typically expressed in HEK293T or Escherichia coli systems. Key steps include:

  • Cloning: Full-length mec-2 gene (F14D12.4) inserted into expression vectors .

  • Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged variants) .

  • Validation: Confirmed via Western blot, cholesterol-binding assays, and functional studies in heterologous systems .

Ion-Channel Regulation

Recombinant MEC-2 enhances the activity of DEG/ENaC channels (e.g., MEC-4/MEC-10) by 40-fold in Xenopus oocytes . This activation requires:

  • Direct interaction with the cytoplasmic domain of MEC-4 .

  • Cholesterol binding to stabilize channel complexes .

Table 2: Functional Effects of Recombinant MEC-2 Mutants

MutationEffect on Cholesterol BindingEffect on Channel ActivitySource
P134S (u274 allele)AbolishedLoss of touch sensitivity
C140A/C174AReducedCholesterol-dependent rescue
ΔPHB domainAbolishedNo channel activation

Cholesterol Binding Mechanism

  • Recombinant MEC-2 binds cholesterol via its PHB domain and adjacent hydrophobic regions .

  • Palmitoylation at C140/C174 enhances cholesterol affinity, critical for mechanosensory function .

Applications in Research

Recombinant MEC-2 is utilized to:

  • Study mechanotransduction: Reconstitute MEC-4/MEC-10/MEC-2 complexes in vitro .

  • Investigate lipid-protein interactions: Analyze cholesterol’s role in membrane protein function .

  • Model human diseases: Explore parallels with Podocin (a mammalian PHB-domain protein linked to kidney disorders) .

Research Challenges and Limitations

  • Structural complexity: Full-length MEC-2 forms large multimers (>20 subunits), complicating crystallization .

  • Functional redundancy: Overlaps with UNC-24, another stomatin-like protein in C. elegans, may obscure phenotype interpretation .

Future Directions

  • High-resolution structural studies: Cryo-EM to resolve MEC-2-channel interactions.

  • Therapeutic screening: Test small molecules targeting MEC-2’s cholesterol-binding sites for neuropathic pain or kidney disease.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mec-2; F14D12.4; Mechanosensory protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-481
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
mec-2
Target Protein Sequence
MSATMSSARNSVVSLSSNGSVKVETRLVSNERSSSIQQEGAMLPSSSSKDDDLLSTSSDE VENMATRTLQQLEESTSIISANSDDDSVKKEKQAEKDVEKGNGKEEKANIQNEFGVCGWI LTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRK VDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRN ILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEA AREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPI DLLSAFLQRTPPKVEEPPSLPKKIRSCCLYKYPDWVQGMVGSEGGGGHGHSHGGGGGGLG SSQGAFHPSQAGSGPSTTTTSGRPLLRSMREAQFHSAAPPISAPNQSQTSVSQLDPALLI R
Uniprot No.

Target Background

Function
Recombinant Mechanosensory protein 2 (MEC-2) is a subunit of an amiloride-sensitive cation channel (degenerin channel complex) permeable to sodium, potassium, lithium, and N-methylglucamine. It is crucial for mechanosensory transduction (touch sensitivity) and positively regulates the activity of the putative mechanosensory transduction channel. MEC-2 may link the mechanosensory channel to the microtubule cytoskeleton of touch receptor neurons and is essential for the function of a specific set of six touch receptor neurons.
Gene References Into Functions
  1. The carboxyl terminus of podocin/MEC-2 must be located in the inner leaflet of the plasma membrane to mediate cholesterol binding and contribute to ion channel activity. PMID: 24596097
  2. Similar to stomatins in other species, C. elegans counterparts are likely membrane proteins with intracellular amino- and carboxyl-terminals. PMID: 21501885
  3. MEC-2, Podocin, and likely many other PHB-domain proteins regulate the formation and function of large protein-cholesterol supercomplexes in the plasma membrane through self-interaction, cholesterol binding, and interaction with target proteins. PMID: 17079490
  4. MEC-2, in conjunction with MEC-6, increases the open probability of ENaC (constitutively active MEC-4/MEC-10 in Xenopus oocytes) and reduces the effectiveness of Ca2+ block. Its palmitoylation and cholesterol-binding activities are necessary for channel activation. PMID: 18504316
Database Links

KEGG: cel:CELE_F14D12.4

STRING: 6239.F14D12.4a

UniGene: Cel.7750

Protein Families
Band 7/mec-2 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is MEC-2 and what are its primary functional characteristics?

MEC-2 is a stomatin-related membrane-associated scaffolding protein that plays a crucial role in mechanosensation. It functions as an auxiliary subunit that dramatically enhances the activity of DEG/ENaC (degenerin/epithelial sodium channel) proteins, particularly MEC-4 and MEC-10, which are required for touch sensation in C. elegans. MEC-2 can increase the activity of these channels by approximately 40-fold, enabling mechanically-gated currents to be detected with wild-type MEC-4 and MEC-10 .

MEC-2 does not cross the lipid bilayer but associates with the inner leaflet of the plasma membrane through its prohibitin homology (PHB) domain and an adjacent hydrophobic region . Recent research has shown that MEC-2 undergoes a remarkable rigidity phase transition from fluid-like to solid-like condensates, with the distinct phases facilitating different functions: transport and mechanotransduction, respectively .

How does MEC-2 regulate touch-sensitive ion channels?

MEC-2 regulates touch-sensitive ion channels through multiple mechanisms:

  • Increased channel activity: MEC-2 significantly enhances the activity of MEC-4/MEC-10 channels without increasing their surface expression . When co-expressed with MEC-6 (a paraoxonase-like protein), MEC-2 can increase macroscopic current by more than 100-fold .

  • Cholesterol binding: MEC-2 binds cholesterol through its PHB domain and part of its N-terminally adjacent hydrophobic domain. This cholesterol binding is essential for MEC-2-dependent activation of mechanosensation .

  • Channel state regulation: Rather than dramatically affecting single-channel properties or surface expression, MEC-2 and MEC-6 increase the number of channels in an active state, effectively modulating the local membrane environment of MEC-4/MEC-10 channels .

  • Protein complex formation: MEC-2 binds to the N-terminal domain of MEC-4 through its central PHB domain, helping to organize mechanosensory complexes in the membrane .

What domains characterize the MEC-2 protein and how do they contribute to its function?

MEC-2 contains several key structural domains that contribute to its function:

DomainLocationFunction
Prohibitin Homology (PHB) domainCentral regionPrimary functional domain; 65% identical to human stomatin; mediates binding to MEC-4 N-terminal domain; contains palmitoylation sites essential for cholesterol binding
Hydrophobic regionN-terminal to PHB domainAttaches protein to inner leaflet of plasma membrane; contributes to cholesterol binding
Membrane association regionN-terminalDoes not cross bilayer but associates with inner membrane leaflet

The PHB domain is critical for MEC-2 function, as it mediates interactions with both channel proteins and membrane cholesterol . Interestingly, neither the central, stomatin-like domain of MEC-2 nor human stomatin alone retained the full activity of MEC-2, although both could produce amiloride-sensitive currents with mutant MEC-4 (MEC-4d) . This indicates that the specific configuration and interaction of these domains is essential for MEC-2's full functionality.

How does MEC-2 bind cholesterol and why is this interaction physiologically important?

MEC-2 binds cholesterol through a mechanism that requires:

  • The intact PHB domain, including palmitoylation sites within it

  • Part of the N-terminally adjacent hydrophobic domain that attaches the protein to the inner leaflet of the plasma membrane

This cholesterol binding is physiologically critical because:

  • It allows cholesterol to associate with ion-channel complexes to which MEC-2 binds (DEG/ENaC channels)

  • MEC-2-dependent activation of mechanosensation requires cholesterol

  • It facilitates the formation and function of large protein-cholesterol supercomplexes in the plasma membrane

Mutations that disrupt cholesterol binding impair MEC-2 function, affecting both whole-cell and single-channel currents . This highlights the essential role of plasma membrane sterols in modulating ion-channel activity, particularly in mechanosensation contexts.

What is the liquid-to-solid phase transition of MEC-2 and how does it affect function?

Recent research has revealed that MEC-2/stomatin undergoes a rigidity phase transition from fluid-like to solid-like condensates, with each phase serving distinct biological functions:

  • Fluid-like phase: Facilitates transport of MEC-2 within the cell

  • Solid-like phase: Supports mechanotransduction functionality

This transition is triggered by the interaction between the SH3 domain of UNC-89 (a titin/obscurin homolog) and MEC-2. The physiological relevance of this phase transition appears to be in frequency-dependent force transmission in mechanosensitive neurons during body wall touch .

This finding demonstrates a non-pathological function for the distinct liquid and solid phases of biomolecular condensates within the same cell, where:

  • Simple fluids cannot sustain mechanical forces

  • Solid-like properties enable effective mechanotransduction

What experimental approaches can be used to study MEC-2 phase transitions?

Researchers investigating MEC-2 phase transitions can employ several methodologies:

  • Fluorescence recovery after photobleaching (FRAP): To measure the fluidity/solidity of MEC-2 condensates

  • Atomic force microscopy: To determine the mechanical properties of different phase states

  • Optogenetic tools: To trigger phase transitions in a temporally controlled manner

  • In vivo imaging: Using C. elegans as a model organism to visualize phase transitions in live neurons

  • Protein interaction assays: To identify factors like UNC-89 that trigger the phase transition

These approaches allow researchers to correlate the material properties of MEC-2 condensates with their functional roles in mechanosensation and transport.

What expression systems are optimal for recombinant MEC-2 production and functional studies?

Based on the research literature, several expression systems have been successfully used for MEC-2 studies:

  • Xenopus oocytes: The most widely used system for functional studies of MEC-2 and its interaction with ion channels. Oocytes allow for co-expression of multiple proteins (MEC-2, MEC-4, MEC-10, MEC-6) and enable electrophysiological recordings to assess channel function .

  • Bacterial expression systems: For the production of recombinant MEC-2 protein for biochemical and structural studies. Constructs encoding full-length, wild-type MEC-2 have been propagated in XL1-Blue bacteria .

  • SMC4 bacteria: For propagating constructs encoding MEC-4d and MEC-10d (American Type Culture Collection accession no. PTA-4084) .

When expressing MEC-2 for functional studies, researchers should consider:

  • Using intact oocytes 4 days after cRNA injection

  • Homogenizing in appropriate buffer with protease inhibitors

  • Detecting MEC-2 by Western blotting with anti-MEC-2 rabbit primary antibodies

How can researchers assess MEC-2-channel interactions and functional effects?

Several methodological approaches can be used to study MEC-2-channel interactions:

MethodApplicationKey Measurements
Two-electrode voltage clampWhole-cell currents in Xenopus oocytesMacroscopic current amplitude, channel activation, effects of divalent cations and proteases
Outside-out macropatch recordingDetailed electrophysiological analysisEffects of regulators like divalent cations and proteases
Single-channel recordingsChannel propertiesOpen probability, conductance, channel kinetics
Biochemical assaysProtein-protein interactionsCo-immunoprecipitation, pull-down assays
Surface expression analysisTrafficking effectsBiotinylation assays, confocal microscopy

When assessing the effects of MEC-2 on channel function, researchers often use constitutively active "degenerin" mutant forms of MEC-4 and MEC-10 (MEC-4d and MEC-10d), which facilitate measurement of the effects of auxiliary subunit coexpression . This approach is valid because all available evidence suggests that the effects of MEC-2 and MEC-6 on current are similar in wild-type and degenerin mutant channels .

How do MEC-2 and MEC-6 synergistically regulate ion channel function?

MEC-2 and MEC-6 together dramatically enhance the function of MEC-4/MEC-10 channels through a synergistic mechanism:

  • Magnitude of effect: Together, they increase macroscopic current by more than 100-fold .

  • Mechanism of action: Rather than increasing surface expression of channel proteins, they increase the number of channels in an active state .

  • Channel activation: MEC-2 and MEC-6 alter the functionality of channels already present in the membrane rather than dramatically affecting either single-channel properties or surface expression .

  • Membrane environment modulation: They appear to play essential roles in modulating the local membrane environment of MEC-4/MEC-10 channels, affecting the availability of such channels to be gated by force in vivo .

Researchers studying this synergy should consider experimental designs that allow for precise control over the expression levels of all components, as well as methodologies to distinguish between effects on trafficking, surface expression, and channel gating.

What is the relationship between MEC-2 and extracellular matrix proteins in mechanosensation?

MEC-2, though associated with the inner leaflet of the plasma membrane, functions within a complex mechanosensory apparatus that includes extracellular matrix proteins:

  • MEC-5: A collagen made by the epidermal cells that surround the touch cells. Mutations in the Gly-X-Y repeats of this collagen cause touch insensitivity .

  • MEC-9: A protein with 5 Kunitz-type protease inhibitor domains, 6 EGF-like repeats, and a glutamic acid-rich region. Missense mutations in both the EGF-like and Kunitz domains cause touch insensitivity .

  • Genetic interactions: mec-9 loss of function mutations dominantly enhance the touch insensitive phenotype of several mec-5 mutations, suggesting MEC-5 and MEC-9 may interact .

These extracellular proteins are believed to provide an extracellular attachment point for the mechanosensory channels of the touch cells . This creates a comprehensive mechanotransduction complex that spans from the extracellular matrix through the membrane to the intracellular components, including MEC-2.

How should researchers interpret contradictory results in MEC-2 functional studies?

When encountering contradictory results in MEC-2 research, consider the following methodological approaches:

  • Evaluate expression systems: Different expression systems (oocytes vs. cell lines vs. in vivo models) may yield varying results due to differences in membrane composition, auxiliary protein expression, or post-translational modifications.

  • Consider protein isoforms and mutations: Ensure consistency in the specific MEC-2 constructs used across studies. Minor differences in protein sequence can significantly impact function.

  • Assess experimental conditions: Factors such as temperature, ionic composition of solutions, and membrane cholesterol content can dramatically affect MEC-2 function and its interaction with ion channels .

  • Examine temporal dynamics: The phase transition properties of MEC-2 from fluid-like to solid-like condensates means that the timing of measurements after expression is crucial .

  • Statistical validation: Apply rigorous statistical analysis to experimental data, particularly when testing hypotheses about MEC-2 function. The MECLABS methodology emphasizes experimental science principles with formal test protocols and statistical validation of outcomes .

What controls are essential for validating MEC-2 functional assays?

Researchers should implement the following controls when conducting MEC-2 functional studies:

  • Expression controls: Western blotting to confirm similar expression levels of MEC-2 across experimental conditions .

  • Surface expression controls: Biotinylation assays to verify that changes in channel activity are not due to altered trafficking to the plasma membrane .

  • Channel functionality controls: Expression of channels without MEC-2 to establish baseline activity levels.

  • Pharmacological controls: Application of amiloride to confirm the specificity of measured currents, as MEC-2-enhanced channels are amiloride-sensitive .

  • Mutant controls: Use of MEC-2 mutants deficient in cholesterol binding to validate the role of lipid interactions in channel regulation .

  • Statistical controls: Implementation of appropriate sample sizing and statistical test planning to ensure validity of results and reliable detection of effects .

What are the emerging research areas in MEC-2 biology?

Several promising research directions are emerging in the field of MEC-2 biology:

  • Phase separation biology: Further investigation into how the liquid-to-solid phase transition of MEC-2 is regulated and its precise role in mechanotransduction .

  • Therapeutic applications: Exploring how understanding MEC-2 function might inform development of therapies for disorders of mechanosensation or ion channel dysfunction.

  • Comparative biology: Investigating the functional conservation between MEC-2 and mammalian stomatin-like proteins (SLPs) in mechanosensation .

  • Structural biology: Determining high-resolution structures of MEC-2 in complex with channel proteins and cholesterol to elucidate the molecular basis of its regulatory effects.

  • Mechanical force transduction: Developing new methodologies to directly measure how MEC-2 condensates respond to mechanical stimuli and transmit force to ion channels.

  • Systems biology approach: Integrating MEC-2 function into comprehensive models of mechanosensory transduction that include all components from extracellular matrix to intracellular signaling.

How might advanced imaging techniques enhance MEC-2 research?

Advanced imaging methodologies can significantly advance MEC-2 research:

  • Super-resolution microscopy: Techniques like PALM, STORM, or STED can visualize the nanoscale organization of MEC-2 with ion channels in the membrane.

  • Live-cell imaging: Tracking the dynamics of MEC-2 phase transitions in real-time during mechanosensory responses.

  • FRET/FLIM analysis: Measuring protein-protein interactions between MEC-2 and channel proteins or between MEC-2 and cholesterol (using fluorescent cholesterol analogs).

  • Correlative light and electron microscopy (CLEM): Combining functional fluorescence imaging with ultrastructural analysis of MEC-2 condensates.

  • Cryo-electron tomography: Visualizing the three-dimensional organization of MEC-2 and associated proteins in their native cellular environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.