Recombinant Medicago sativa Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Role in Photosynthesis

The Photosystem Q(B) protein (D1 protein) is a core subunit of PSII, participating in light-driven water oxidation and electron transfer. Recombinant variants enable structural and functional studies, including:

  • Mechanistic studies of herbicide binding: The Q(B) site binds plastoquinone, a process disrupted by herbicides like DCMU. Recombinant proteins facilitate in vitro assays to study herbicide resistance .

  • Salt stress responses: Transcriptomic/proteomic studies in Medicago sativa highlight PSII proteins as key regulators under salinity stress. Recombinant Q(B) could model stress-induced modifications .

Comparative Analysis with Other Organisms

The Medicago sativa Q(B) protein shares structural homology with cyanobacterial counterparts (e.g., Synechococcus elongatus P0A447). Below is a comparison:

FeatureMedicago sativa (P04998)Synechococcus elongatus (P0A447)
Expression HostE. coliE. coli
TagHis (N-terminal)His (N-terminal)
Protein Length2–344 aa1–344 aa
Purity>90%>90%
Storage BufferTris/PBS-basedTris/PBS-based

Sources: Creative Biomart

Quality Control

Purity is confirmed via SDS-PAGE, ensuring no contamination or degradation. Functional assays (e.g., herbicide binding) validate biological activity .

Future Directions

The recombinant Q(B) protein serves as a model for:

  1. Structure-function studies: Mutagenesis to probe quinone-binding residues.

  2. Salt stress research: Investigating post-translational modifications (e.g., phosphorylation) in salt-tolerant alfalfa varieties .

  3. Biotechnological applications: Engineering herbicide-resistant crop strains or photosynthetic biomaterials.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us. We will prioritize the development of your requested tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Medicago sativa (Alfalfa)
Target Names
psbA
Target Protein Sequence
TAILERRDSETLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIICGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Medicago sativa and how does it function?

Photosystem Q(B) protein, also known as the D1 protein or psbA gene product, is a critical component of Photosystem II (PSII) in the photosynthetic apparatus of Medicago sativa. The protein functions as a binding site for the exchangeable plastoquinone (QB), which accepts electrons from the primary quinone acceptor (QA) during photosynthetic electron transport. The QB site enables sequential two-electron reduction, forming first a semiquinone (QB- −) and then a fully reduced quinol (QBH2), which is subsequently released into the membrane plastoquinone pool .

The protein's function is fundamentally tied to its ability to facilitate electron transfer while maintaining optimal redox potentials that minimize back-reactions and electron leakage to oxygen. This process is critical for efficient photosynthesis and plant energy production .

How do I optimize expression of recombinant Medicago sativa Photosystem Q(B) protein?

For optimizing expression of recombinant Medicago sativa Photosystem Q(B) protein, consider the following methodological approach:

What protocols are recommended for extracting and purifying recombinant Photosystem Q(B) protein from Medicago sativa?

Extraction and Purification Protocol:

  • Buffer Preparation:

    • Extraction buffer: 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 1% detergent (DDM or Triton X-100), 1 mM PMSF, and protease inhibitor cocktail

    • Washing buffer: 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 0.1% detergent, 20 mM imidazole

    • Elution buffer: 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 0.1% detergent, 250 mM imidazole

  • Cell Lysis and Protein Extraction:

    • For recombinant protein from E. coli: Use sonication or French press in extraction buffer

    • For native protein from plant tissue: Grind leaf tissue in liquid nitrogen, then extract in buffer containing CaCl2 and EGTA sequentially to release cell wall-associated proteins

  • Purification Strategy:

    • Affinity chromatography: Use Ni-NTA resin for His-tagged proteins

    • Size exclusion chromatography: Further purify using a Superdex 200 column

    • Consider applying a 3D characterization approach combining 2-DE with aqueous two-phase partitioning to separate the target protein from contaminants

  • Quality Control:

    • Verify purity by SDS-PAGE (aim for >90% purity)

    • Confirm identity by Western blot or mass spectrometry

    • Assess protein folding by circular dichroism spectroscopy

How do I measure and characterize the redox properties of recombinant Photosystem Q(B) protein?

Characterizing the redox properties of recombinant Photosystem Q(B) protein requires specialized techniques:

Table 1: Typical Redox Potential Values for Photosystem II Components

Redox CoupleMidpoint Potential (mV)Method of Determination
QB/QB- −~90EPR spectroscopy
QB- −/QBH2~40EPR spectroscopy
QB/QBH2~65Calculated average
QA/QA- −~-124Literature value
PQ/PQH2 (pool)~117Literature value

The difference between QB/QB- − and QA/QA- − potentials (~234 meV) represents the thermodynamic driving force for electron transfer .

What techniques are most effective for analyzing protein-protein interactions involving the Photosystem Q(B) protein?

Several complementary techniques can be employed to study protein-protein interactions involving Photosystem Q(B) protein:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against the His-tag or specific epitopes of the Q(B) protein

    • Analyze precipitated complexes by mass spectrometry to identify interaction partners

    • Western blot verification with antibodies against suspected interaction partners

  • Cross-linking Mass Spectrometry:

    • Apply chemical cross-linkers (e.g., BS3, DSS, or EDC) to stabilize transient interactions

    • Digest cross-linked complexes with trypsin

    • Analyze by LC-MS/MS to identify cross-linked peptides

    • Map interaction interfaces based on cross-link positions

  • Blue Native PAGE:

    • Particularly useful for analyzing intact membrane protein complexes

    • Extract protein complexes using mild detergents (digitonin or DDM)

    • Separate native complexes on gradient gels

    • Analyze composition by second-dimension SDS-PAGE or mass spectrometry

  • Fluorescence Resonance Energy Transfer (FRET):

    • Generate fluorescently labeled versions of the Q(B) protein and potential partners

    • Measure energy transfer as an indicator of protein proximity

    • Calculate interaction distances based on FRET efficiency

When applying these techniques to Medicago sativa Photosystem Q(B) protein, consider the hydrophobic nature of this membrane protein and adjust protocols accordingly with appropriate detergents and buffer conditions to maintain native interactions .

How do environmental stresses affect the structure and function of Photosystem Q(B) protein in Medicago sativa?

Environmental stresses significantly impact Photosystem Q(B) protein structure and function in Medicago sativa. Research indicates:

  • Heavy Metal Stress (Cadmium):

    • Decreases abundance of photosynthetic proteins, including Photosystem II components

    • Induces oxidative stress through ROS production, leading to protein oxidation and degradation

    • Activates proteolytic enzymes (particularly aspartyl proteases) that target photosynthetic proteins

    • Increases abundance of chloroplastic heat shock proteins (70 kDa stromal HSP), indicating protein misfolding

  • Mechanisms of Stress-Induced Damage:

    • ROS-mediated oxidation of protein components

    • Impairment of electron transfer between QA and QB

    • Alteration of redox potential values affecting thermodynamic stability

    • Degradation of D1 protein (which contains the QB binding site) by activated proteases

  • Adaptive Responses:

    • Induction of specific protease isoforms for controlled degradation of damaged components

    • Upregulation of chaperones to assist in protein refolding

    • Modifications in protein turnover rates to replace damaged D1 protein

These stress responses are particularly relevant when studying recombinant systems, as expression conditions may induce similar stress responses that affect protein quality .

What are the key differences in redox properties between recombinant and native Photosystem Q(B) protein?

The redox properties of recombinant versus native Photosystem Q(B) protein may differ due to several factors:

  • Protein Environment Effects:

    • Recombinant proteins expressed in E. coli lack the native thylakoid membrane environment

    • The absence of lipids and other PSII components may alter the local electrostatic environment

    • Changes in hydrogen bonding networks can significantly impact redox potentials

  • Critical Determinants of Redox Properties:

    • Protonation events coupled to electron transfer

    • Proximity to charged amino acids

    • Solvent accessibility of the quinone binding site

    • Presence of coordinating amino acids and water molecules

  • Experimental Considerations:

    • Reconstitution with lipids may partially restore native-like properties

    • Measurements should be performed at physiologically relevant pH values (pH 6.5-7.5)

    • Temperature effects should be considered, as redox potentials are temperature-dependent

Table 2: Comparison of Redox Properties Between Native and Recombinant Systems

ParameterNative PSIIRecombinant SystemPotential Impact
QB/QB- − midpoint potential~90 mVMay vary ±30 mVAltered electron transfer kinetics
QB binding affinityHigh selectivityPotentially reducedAltered substrate specificity
pH dependence~60 mV/pH unitMay show altered slopeDifferent protonation coupling
Temperature dependenceEntropy-drivenMay differChanged thermodynamics

These differences must be considered when interpreting experimental results from recombinant systems and extrapolating to in vivo function .

How can I analyze post-translational modifications of Medicago sativa Photosystem Q(B) protein?

Analysis of post-translational modifications (PTMs) on Medicago sativa Photosystem Q(B) protein requires a multi-technique approach:

  • Mass Spectrometry-Based Workflow:

    • Perform in-gel or in-solution digestion with multiple proteases (trypsin, chymotrypsin)

    • Analyze peptides using LC-MS/MS with high-resolution mass analyzers (Orbitrap or Q-TOF)

    • Apply complementary fragmentation techniques (CID, HCD, ETD) for comprehensive coverage

    • Use neutral loss scanning to detect specific modifications (phosphorylation, glycosylation)

    • Implement data-dependent and data-independent acquisition methods

  • 2D Electrophoresis Approach:

    • Use 2D-DIGE to visualize different protein isoforms and modified forms

    • Identify spots with shifted pI or molecular weight compared to theoretical values

    • Excise spots of interest for MS identification

    • Create PTM maps based on spot patterns

  • Targeted Analysis of Common PTMs:

    • Phosphorylation: Use phospho-specific antibodies, Phos-tag gels, or titanium dioxide enrichment

    • Oxidative modifications: Apply derivatization with DNPH for carbonylation detection

    • Glycosylation: Use lectin affinity approaches or specific glycan-detecting stains

    • Ubiquitination/SUMOylation: Use specific antibodies or tandem ubiquitin binding entities (TUBEs)

  • Software Tools for PTM Data Analysis:

    • MaxQuant/Andromeda for identification and quantification

    • PTM-Shepherd for unbiased PTM discovery

    • PTM-Compass for integrating multiple PTM datasets

    • PEAKS Studio for de novo sequencing and PTM discovery

This comprehensive approach allows mapping of PTMs that may regulate protein function, stability, or interaction capabilities .

How do I resolve inconsistent results when measuring electron transfer activities in recombinant Photosystem Q(B) protein?

Inconsistent electron transfer measurements with recombinant Photosystem Q(B) protein can be addressed through systematic troubleshooting:

  • Common Sources of Variability:

    • Protein denaturation during purification or storage

    • Detergent effects on quinone binding site accessibility

    • Incomplete reconstitution with cofactors

    • Variations in quinone substrate quality or concentration

    • pH and temperature fluctuations affecting redox potentials

  • Methodological Standardization:

    • Implement strict temperature control (±0.1°C) during measurements

    • Establish standard buffer compositions with controlled ionic strength

    • Use internal standards for calibrating electrochemical measurements

    • Standardize protein:detergent and protein:lipid ratios

    • Prepare fresh quinone stocks and verify concentration spectrophotometrically

  • Quality Control Checkpoints:

    • Verify protein integrity before each experiment by circular dichroism

    • Confirm quinone binding through fluorescence quenching assays

    • Validate redox mediator set by testing with known standards

    • Run parallel measurements with native thylakoid membranes for comparison

  • Data Analysis Approach:

    • Apply statistical outlier tests to identify anomalous measurements

    • Use weighted averaging when combining datasets from multiple preparations

    • Consider Bayesian approaches for parameter estimation from heterogeneous datasets

    • Report confidence intervals rather than single values for redox parameters

What approaches help resolve contradictory findings on redox potentials reported in different studies?

Resolving contradictions in reported redox potentials for Photosystem Q(B) protein requires careful analysis of methodological differences:

  • Critical Experimental Variables:

    • Measurement technique: EPR vs. FTIR vs. electrochemical methods

    • Sample preparation: Detergent type and concentration, protein purity

    • Experimental conditions: pH, temperature, ionic strength

    • Calculation methods: Direct measurement vs. equilibrium assumptions

  • Systematic Analysis Framework:

    • Create a comparison table of all reported values with experimental conditions

    • Normalize values to standard conditions (typically pH 7.0, 25°C)

    • Apply correction factors for different reference electrodes

    • Evaluate internal consistency within each study (e.g., ΔE between redox couples)

  • Resolution Strategies:

    • Perform side-by-side comparisons using multiple techniques on the same sample

    • Design experiments to specifically test competing hypotheses

    • Consider computational approaches (e.g., QM/MM) to evaluate theoretical values

    • Examine the influence of experimental perturbations on measured values

For example, recent contradictory findings regarding Q(B) redox couples were resolved through careful EPR measurements, which showed that Q(B)- − is thermodynamically stable (E(QB/QB- −) ≈ 90 mV), contradicting earlier FTIR-based reports suggesting instability .

How can I determine if my recombinant Photosystem Q(B) protein preparation maintains native-like structure and function?

Verifying native-like structure and function of recombinant Photosystem Q(B) protein requires multiple complementary approaches:

  • Structural Assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content

    • Intrinsic tryptophan fluorescence to assess tertiary structure

    • Size exclusion chromatography to confirm proper oligomeric state

    • Limited proteolysis patterns compared to native protein

  • Functional Validation:

    • Quinone binding assays using fluorescence quenching or isothermal titration calorimetry

    • Electron transfer kinetics measured by flash photolysis or time-resolved spectroscopy

    • Redox potential measurements using EPR or electrochemical methods

    • pH dependence of activity compared to native systems

  • Biochemical Criteria:

    • Proper folding indicated by resistance to proteolysis

    • Specific binding of known interaction partners

    • Expected post-translational modifications

    • Thermal stability profile similar to native protein

  • Quantitative Comparison Metrics:

    Table 3: Benchmark Parameters for Native-like Q(B) Function

    ParameterNative ValueAcceptable Range for RecombinantAssessment Method
    QB/QB- − potential~90 mV±20 mVEPR titration
    QB- −/QBH2 potential~40 mV±20 mVEPR titration
    Electron transfer rate (QA- − to QB)~200-400 s⁻¹>100 s⁻¹Flash photolysis
    Quinone binding affinityKd ~100 nM<500 nMITC or fluorescence
    α-helical content~45-50%±5%CD spectroscopy

    These quantitative benchmarks provide clear criteria for evaluating the quality of recombinant preparations .

What are emerging techniques for studying the dynamics of electron transfer in recombinant Photosystem Q(B) protein?

Cutting-edge approaches for investigating electron transfer dynamics in recombinant Photosystem Q(B) protein include:

  • Time-Resolved Spectroscopic Methods:

    • Ultrafast transient absorption spectroscopy (femtosecond to nanosecond)

    • Time-resolved EPR to track radical pair formation and decay

    • Pulse radiolysis coupled with spectroscopic detection

    • 2D electronic spectroscopy to map energy transfer pathways

  • Single-Molecule Techniques:

    • Single-molecule FRET to monitor conformational dynamics during electron transfer

    • Patch-clamp fluorometry to correlate structural changes with electron transfer events

    • Single-molecule electrochemistry using nanoscale electrodes

    • Super-resolution microscopy to visualize quinone movement within proteins

  • Advanced Computational Approaches:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations

    • Non-adiabatic molecular dynamics to model electron transfer

    • Machine learning for predicting electron transfer pathways

    • Coarse-grained simulations of long-timescale dynamics

  • Synthetic Biology Strategies:

    • Site-specific incorporation of spectroscopic probes via unnatural amino acids

    • Designer quinones with photo-triggered properties

    • Minimal synthetic systems that recapitulate key electron transfer steps

    • Hybrid systems combining biological and artificial components

These emerging techniques promise to reveal the dynamic aspects of electron transfer that are inaccessible to static structural or equilibrium measurements.

How can genetic modifications of Medicago sativa be used to optimize Photosystem Q(B) protein for research purposes?

Genetic modifications of Medicago sativa can enhance Photosystem Q(B) protein for research applications through several strategies:

  • Targeted Modifications:

    • Site-directed mutagenesis of key residues in the quinone binding pocket

    • Introduction of spectroscopic probes (e.g., fluorescent amino acids)

    • Addition of affinity tags for improved purification

    • Engineering thermostable variants for expanded experimental conditions

  • Expression Enhancement Strategies:

    • Codon optimization for increased expression levels

    • Modification of regulatory elements to boost transcription

    • Engineering of chloroplast transformation vectors for expression in native compartment

    • Development of inducible expression systems for temporal control

  • Functional Modifications:

    • Tuning redox potentials through targeted amino acid substitutions

    • Engineering variants with altered quinone specificity

    • Creating chimeric proteins with components from other species

    • Introducing resistance to photoinhibition for improved stability

  • Vector and Delivery Systems:

    • Agrobacterium-mediated transformation protocols optimized for Medicago sativa

    • Biolistic delivery methods for chloroplast transformation

    • CRISPR/Cas9 systems for precise genome editing

    • Viral vectors for rapid transient expression

These genetic approaches provide powerful tools for creating customized Photosystem Q(B) protein variants tailored for specific research questions.

What computational models best predict the impact of mutations on Photosystem Q(B) protein function?

Computational modeling of mutations in Photosystem Q(B) protein requires sophisticated approaches:

  • Structure-Based Prediction Methods:

    • Homology modeling based on crystal structures of cyanobacterial PSII

    • Molecular dynamics simulations to assess structural stability

    • Free energy perturbation calculations for binding energy differences

    • Electrostatic calculations to predict redox potential shifts

  • Machine Learning Approaches:

    • Neural networks trained on experimental mutation datasets

    • Random forest algorithms for predicting stability changes

    • Support vector machines for classifying functional impacts

    • Deep learning frameworks integrating sequence and structural features

  • Quantum Mechanical Methods:

    • QM/MM approaches for modeling the quinone binding site

    • Electronic structure calculations to predict redox potentials

    • Electron transfer pathway analysis using tunneling current calculations

    • Excited state dynamics for modeling photoactivation

  • Integrated Computational Workflows:

    Table 4: Computational Prediction Methods for Different Functional Parameters

    ParameterRecommended MethodTypical AccuracyComputational Cost
    Protein stabilityRosetta ΔΔG±1 kcal/molMedium
    Quinone bindingMM-PBSA/MM-GBSA±1-2 kcal/molMedium-High
    Redox potentialQM/MM with DFT±50 mVVery High
    Electron transfer rateTunneling pathway analysisOrder of magnitudeHigh
    pH sensitivityContinuum electrostatics±0.5 pH unitsMedium

    These computational approaches enable rational design of mutations to test specific hypotheses about Q(B) function and can guide experimental workflows .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.