Recombinant Medicago truncatula Bidirectional sugar transporter N3 (N3)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Medicago truncatula Bidirectional sugar transporter N3 (N3) is a recombinant protein derived from Medicago truncatula, a model legume species. It belongs to the SWEET (sugars will eventually be exported transporter) family, which facilitates bidirectional sugar transport across cellular membranes by acting as a uniporter or channel protein . N3 is also known as Nodulin 3 (MtN3 or N-3), a nodule-specific protein implicated in symbiotic interactions, though its exact physiological role remains understudied compared to other SWEET transporters .

Experimental Use

Recombinant N3 is primarily utilized in:

  • SDS-PAGE: For purity validation and molecular weight confirmation .

  • ELISA assays: To detect N3 expression levels in plant tissues or recombinant systems .

Symbiotic and Physiological Relevance

Though N3’s role is not directly studied, SWEET transporters in Medicago truncatula are critical in:

  • AM symbiosis: MtSWEET1b transports glucose to arbuscules, ensuring fungal nutrient uptake and symbiotic maintenance .

  • Nodule development: Nodulins like N3 may regulate sugar allocation during root nodule formation .

Comparative Analysis of SWEET Transporters in Medicago truncatula

TransporterLocalizationPrimary SubstrateKey Function
N3Nodules (predicted)Sucrose/GlucoseSymbiotic sugar allocation (hypothesized)
MtSWEET1bPeri-arbuscular membraneGlucoseAM symbiosis maintenance
MtSWEET11Phloem membranesSucroseSucrose efflux for long-distance transport

Limitations and Future Directions

  • Limited Functional Data: No direct studies on N3’s substrate specificity or membrane localization exist in the literature.

  • Redundancy in SWEET Family: Overexpression/knockout experiments for MtSWEET1b revealed functional redundancy, suggesting similar compensatory mechanisms may apply to N3 .

  • Commercial Constraints: Recombinant N3 is primarily marketed for structural/immunological studies, not functional assays .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
N3; Bidirectional sugar transporter N3; Nodulin 3; MtN3; N-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Medicago truncatula (Barrel medic) (Medicago tribuloides)
Target Names
N3
Target Protein Sequence
MAISHNTLAFTFGMLGNVISFLVFLAPISTFYRIYKKKSTEGFQSLPYLVALFSSMLWLY YALLKKDAFLLITINSFGCVVETIYIILYIIYAPRDARNLTFKLLSAMNVGSFALILIVT NYAVHGPLRVQVLGWVCVSLSVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSATMWF GYGFFLKDICIXLPNVLGXVLGLLQMLLYAIYRNGGEKAMKKEKKAPIEPPKSIVIETQL EKIEQEKKNKDDDNEEKDKSEEPIGCGV
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the SWEET gene family in Medicago truncatula and how are these transporters classified?

The SWEET gene family in M. truncatula comprises 25 members that mediate the translocation of sugars across cell membranes. Based on phylogenetic analysis, MtSWEET genes are divided into four distinct clades (I-IV) . This classification generally correlates with substrate specificity, though exceptions exist:

  • Clade I and II: Primarily transport hexoses like glucose and galactose

  • Clade III: Mainly involved in sucrose transport

  • Clade IV: Principally involved in fructose transport

How are SWEET transporters structurally organized in M. truncatula?

Most MtSWEET genes contain five introns and encode proteins with seven transmembrane helices (TMHs) . The transmembrane domains are highly conserved across the family, suggesting functional importance in the transport mechanism. Analysis of protein structure reveals that nearly all MtSWEET proteins have relatively conserved membrane domains and contain conserved active sites essential for sugar transport functionality .

What is the expression pattern of SWEET transporters in different tissues of M. truncatula?

Analysis of microarray data reveals that MtSWEET genes exhibit tissue-specific expression patterns across different developmental stages and tissues:

  • Some MtSWEET genes are specifically expressed in flowers

  • Others show high expression in developing seeds

  • Several MtSWEET genes are specifically upregulated in nodules

For example, MtSWEET11, a sucrose-specific transporter, is strongly expressed in roots infected with rhizobia, indicating its potential role in root nodulation processes .

How do MtSWEET transporters respond to abiotic stresses?

RNA-seq and qRT-PCR expression analyses demonstrate that numerous MtSWEET genes are responsive to various abiotic stresses:

  • Cold stress

  • Drought conditions

  • Salt treatments

This stress-responsive expression pattern suggests that sugar transport plays a critical role in the plant's adaptive responses to environmental challenges. The regulation of sugar allocation during stress conditions appears to be a key mechanism for stress tolerance in M. truncatula.

What expression systems are suitable for functional characterization of recombinant MtSWEET proteins?

Yeast complementation assays have proven effective for characterizing the substrate specificity of MtSWEET transporters. The approach involves:

  • Cloning the MtSWEET coding sequence into a yeast expression vector (e.g., pDR196)

  • Transforming the construct into yeast strains deficient in specific sugar transport (e.g., EBY.VW4000, SUSY7/ura3)

  • Evaluating the ability of the recombinant protein to restore growth on specific sugars as the sole carbon source

This methodology has successfully demonstrated that various MtSWEET proteins possess diverse transport activities for sucrose, fructose, glucose, galactose, and mannose .

How can protein localization of MtSWEET transporters be determined in planta?

Fluorescent protein tagging is an effective approach for determining the subcellular localization of MtSWEET transporters. For example:

  • Generate constructs with a fluorescent protein (e.g., GFP) fused to the SWEET gene

  • Express these constructs in plant cells using transient expression or stable transformation

  • Visualize using confocal microscopy to determine subcellular localization

This approach has been successfully employed with other symbiosis-related proteins like NCR343 and NCR-new35, which were shown to localize to the symbiotic compartment .

How do MtSWEET transporters contribute to root nodulation and nitrogen fixation?

MtSWEET transporters play crucial roles in establishing and maintaining symbiotic relationships with nitrogen-fixing bacteria:

  • MtSWEET11, a sucrose-specific transporter, is strongly expressed in roots infected with rhizobia and contributes to root nodulation processes .

  • Sugar transport is essential for providing carbon sources to bacteroids within nodules, supporting their metabolism and nitrogen fixation activity.

  • The bidirectional transport capability allows fine-tuning of sugar allocation between the host plant and symbiotic bacteria.

The importance of appropriate sugar transport is highlighted by studies on other symbiosis-related genes. For instance, mutations in nodule-specific cysteine-rich (NCR) peptides lead to incomplete differentiation of bacteroids and premature senescence in nitrogen fixation zones .

What role do MtSWEET transporters play in arbuscular mycorrhizal symbiosis?

MtSWEET transporters facilitate carbon exchange in arbuscular mycorrhizal (AM) symbiosis:

  • MtSWEET1b appears to be involved in transporting sugars to fungal symbionts, as its expression increases during AM symbiosis .

  • Sugar transport at the periarbuscular membrane (PAM) is critical for maintaining the mutualistic relationship.

  • In related species, SWEET transporters have been shown to operate on the PAM and transport sugars from the cytoplasm to the periarbuscular space and vice versa .

The bidirectional nature of SWEET transporters makes them particularly suited for the dynamic exchange of carbon compounds at the plant-fungus interface.

How is the expression of MtSWEET genes regulated during symbiotic interactions?

The regulation of MtSWEET expression during symbiotic interactions involves complex mechanisms:

  • Transcriptional regulation: Symbiosis-specific transcription factors likely control the expression of MtSWEET genes in response to symbiotic signals.

  • Effector-mediated regulation: Effectors secreted by symbiotic microorganisms may either directly activate the expression of SWEET genes or indirectly through the activation of transcription factors .

  • Spatial regulation: Different MtSWEET genes show distinct expression patterns in various nodule zones, indicating spatial regulation of sugar transport during nodule development.

For comparison, studies on NCR peptides show that genes like NCR169, NCR211, and NCR343 are highly expressed in the interzone and nitrogen fixation zone, while NCR-new35 has significantly lower activity limited to the transition zone of the nodule .

What is the significance of the conserved cysteine residues in MtSWEET transporters?

The conserved cysteine residues in sugar transporters are critical for their function:

  • Studies with related proteins have demonstrated that the first cysteine residue is required for symbiotic function.

  • In NCR343 and NCR-new35, the conserved first cysteine residues are essential for their symbiotic functions .

  • These conserved cysteines likely contribute to proper protein folding, stability, or formation of disulfide bridges that maintain the functional conformation of the transporters.

Understanding the role of these conserved residues provides insights into the structural requirements for functional sugar transport.

How can genome editing approaches be applied to study MtSWEET transporters?

Advanced genome editing tools offer powerful approaches for studying MtSWEET functions:

  • CRISPR/Cas9 system can be used to:

    • Generate knockout mutants by introducing frameshift mutations

    • Create precise point mutations to study specific amino acid residues

    • Develop reporter lines by inserting fluorescent tags

  • TALENs (Transcriptional Activator-Like Effector Nucleases) provide an alternative approach for targeted gene modifications .

Both approaches enable researchers to investigate the specific roles of individual MtSWEET genes in various physiological and developmental processes.

What approaches can be used to study the bidirectional transport mechanism of MtSWEET proteins?

Investigating the bidirectional transport mechanisms of MtSWEET proteins requires sophisticated experimental approaches:

  • Electrophysiological techniques such as patch-clamp recording to measure transport kinetics in both directions

  • Radiolabeled or fluorescently labeled sugar transport assays to quantify influx and efflux rates

  • Structural biology approaches including X-ray crystallography or cryo-electron microscopy to determine the molecular basis of bidirectional transport

  • Computational modeling to simulate the transport cycle and predict the effects of mutations

These complementary approaches can provide comprehensive insights into the bidirectional transport mechanism of MtSWEET proteins.

What are promising areas for future research on M. truncatula sugar transporters?

Several promising research directions could significantly advance our understanding of M. truncatula sugar transporters:

  • Investigating the interplay between sugar transport and hormone signaling pathways

  • Exploring the role of sugar transporters in mediating plant responses to pathogens versus symbiotic microorganisms

  • Developing biosensors based on MtSWEET proteins to monitor sugar fluxes in planta

  • Engineering sugar transport properties to enhance symbiotic efficiency and plant productivity

  • Comparative analysis of sugar transport mechanisms across different legume species to identify conserved and divergent features

These research directions could lead to important discoveries with implications for improving plant-microbe interactions and crop productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.