Recombinant Medicago truncatula Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 (DMI3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Medicago truncatula DMI3

Recombinant Medicago truncatula Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 (DMI3) is a genetically engineered version of the native DMI3 protein, expressed in heterologous systems such as E. coli. This protein kinase plays a central role in symbiotic interactions between legumes and soil microorganisms, including nitrogen-fixing rhizobia and mycorrhizal fungi. DMI3 deciphers calcium oscillations triggered by symbiotic signals (e.g., Nod factors) and transduces these signals into cellular responses critical for nodule formation and infection thread development .

Role in Symbiotic Signaling

DMI3 operates downstream of calcium spiking in the "common symbiotic pathway" shared between rhizobial nodulation and mycorrhizal associations. Key findings include:

Nodulation

  • Epidermal DMI3: Sufficient for infection thread formation in root hairs .

  • Cortical DMI3: Required for nodule primordia formation via cell division induction .

  • Interactions: Binds IPD3 (Interacting Protein of DMI3) in the nucleus, modulating transcriptional responses .

Mycorrhizal Symbiosis

DMI3 is indispensable for arbuscular mycorrhizal colonization, though its substrates in this process remain poorly characterized .

Calcium Signaling Decoding

DMI3 interprets calcium oscillations (spiking) induced by Nod factors. This decoding enables downstream processes like:

  • Nuclear localization: Critical for transcriptional activation of symbiotic genes .

  • IPD3 interaction: Phosphorylates IPD3, which regulates infection thread formation .

Cross-Kingdom Functional Conservation

StudyKey FindingSource
dmi3 mutant rescueRice CCaMK restores nodulation but not infection thread formation
IPD3 interactionDMI3 phosphorylates IPD3, essential for infection and organogenesis
Gain-of-function mutantsConstitutively active DMI3 induces spontaneous nodulation without Nod factors

Applications in Research and Biotechnology

  • Symbiotic Mechanism Studies: DMI3 is used to map phosphorylation targets (e.g., transcription factors, IPD3) in nodulation and mycorrhization .

  • Crop Improvement: Insights into DMI3’s role in nitrogen fixation could inform strategies to enhance symbiotic efficiency in legumes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
CCAMK; DMI3; MTR_8g043970; Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3; CCaMK DMI3; MtCCaMK; Protein DOES NOT MAKE INFECTIONS 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-523
Protein Length
full length protein
Species
Medicago truncatula (Barrel medic) (Medicago tribuloides)
Target Names
DMI3
Target Protein Sequence
MGYGTRKLSDEYEVSEILGRGGFSVVRKGTKKSSIEEEKSQSQVAIKTLRRLGASNNPSG LPRKKDIGEKSTIGFPTMRQVSVSDTLLTNEILVMRRIVENVSPHPNVIDLYDVYEDTNG VHLVLELCSGGELFDRIVAQDKYSETEAATVVHQIASGLEAVHRANIVHRDLKPENCLFL DVRKDSPLKIMDFGLSSVEEFTDPVVGLFGSIDYVSPEALSQGKITTKSDMWSLGVILYI LLSGYPPFIAQNNRQKQQMIMNGNFSFYEKTWKGISQPAKNLISSLLTVDPSKRPSALEL LSDPWVKGEKAKDVQMDPEIVSRLQSFNARRKLRAAAIASVWSSTIFLRTKKLKSLVGSY DLKEEEIENLRMHFKKICADRDNATLSEFEEVLKAMNMLSLIPFASRIFDLFDNNRDGTV DMREILCGFSSLKNSKGEDALRLCFQMYDTDRSGCISKEEVASMLRALPYDCLPTDITEP GKLDEIFDLMDANNDGKVTFDEFKAAMQRDSSLQDVVLSSIRP
Uniprot No.

Target Background

Function
During nodulation, DMI3 plays a crucial role in bacterial infection and nodule organogenesis. This protein kinase recognizes calcium spiking induced by Nod factors, translating this signal to regulate nodulation and mycorrhizal infection responses. It may phosphorylate NSP1 and is essential in epidermal and cortical cells for infection thread (IT) formation in root hairs.
Gene References Into Functions
  1. Phosphorylation at S344 completely inhibits the root nodule symbiosis-supporting function of CCaMK, even with the T271A gain-of-function mutation. PMID: 23869591
  2. The visinin-like domain binds three calcium ions, inducing a conformational change that exposes hydrophobic surfaces and alters tertiary structure without affecting secondary or quaternary structure. PMID: 22889004
Database Links

KEGG: mtr:MTR_8g043970

UniGene: Mtr.6758

Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Subcellular Location
Nucleus.
Tissue Specificity
Highly expressed in roots. Expressed in root hairs and nodules. Expressed at low levels in flowers. Not detected in leaves or stems.

Q&A

What is DMI3 and what role does it play in plant symbiosis?

DMI3 (Does not Make Infections 3) is a calcium and Ca²⁺/calmodulin-dependent protein kinase (CCaMK) that plays a critical role in the signaling pathway establishing root nodule symbiosis with rhizobia bacteria and arbuscular mycorrhizal (AM) symbiosis with fungi. It functions as a central regulatory component of the common symbiotic pathway, interpreting calcium oscillations (calcium spiking) that occur in response to symbiotic signals. DMI3 is essential for initiating the appropriate developmental responses in the host plant that lead to successful symbiotic relationships, including nodule organogenesis and fungal colonization of roots .

The significance of DMI3 is evident in that mutants defective in this gene fail to establish both types of symbiotic relationships, demonstrating its fundamental importance in symbiotic signaling. Research has shown that calcium-dependent autophosphorylation is central to the regulation of CCaMK, which promotes calmodulin binding and activation of downstream targets .

How does DMI3 differ structurally and functionally from DMI1 and DMI2?

The DMI genes (DMI1, DMI2, and DMI3) are all required components of the common symbiotic pathway in Medicago truncatula, but they function at different positions in the signaling cascade:

  • DMI1, DMI2, and DMI3 are located on linkage groups 2, 5, and 8, respectively, as confirmed by both genetic mapping and cytogenetic studies using fluorescent in situ hybridization (FISH) .

  • DMI1 and DMI2 function genetically upstream of DMI3 and are required for DMI3 activation .

  • DMI3 acts as a decoder of the calcium oscillations that are triggered by Nod factor perception and require functional DMI1 and DMI2 .

The distinct chromosomal locations of these genes suggest they evolved independently but converged functionally to control symbiotic signaling. Their sequential action in the signaling pathway highlights the step-wise nature of symbiotic signal transduction.

What are the key regulatory mechanisms of DMI3 during symbiotic interactions?

DMI3 regulation involves several sophisticated mechanisms:

  • Autophosphorylation: Calcium-dependent autophosphorylation is central to DMI3 regulation. Research on Medicago truncatula CCaMK (MtCCaMK) has revealed autophosphorylation of S344 in the calmodulin-binding/autoinhibitory domain as an important regulatory mechanism .

  • Calmodulin binding: Following calcium-dependent autophosphorylation, calmodulin binding to DMI3 promotes its kinase activity toward downstream substrates. Disruption of this interaction, as demonstrated with the phospho-mimic mutation S344D, drastically reduces calmodulin-stimulated substrate phosphorylation .

  • Protein-protein interactions: DMI3 interacts with other proteins such as IPD3, which is important for downstream signaling. The S344D phospho-mimic mutation compromises interaction with both calmodulin and IPD3, indicating the importance of proper phosphorylation states for functional protein interactions .

  • Cell-type specific activation: DMI3 functions in both epidermal and cortical cells, with distinct roles in each cell type. Epidermal DMI3 is sufficient for infection thread formation in root hairs, whereas DMI3 is required in both cell layers for nodule primordia formation .

How do autoactive variants of DMI3 affect downstream symbiotic processes?

Autoactive variants of DMI3 provide powerful tools for understanding symbiotic signaling pathways. The gain-of-function Medicago truncatula DMI3 T271D gene (gofMtDMI3) constitutively activates downstream signaling without requiring upstream calcium signals.

Research findings demonstrate that:

  • When expressed in common bean, gofMtDMI3 induces spontaneous nodulation in the absence of rhizobia, proving its sufficiency to trigger nodule organogenesis .

  • When expressed in rice, gofMtDMI3 does not induce nodule-like structures but supports elevated arbuscular mycorrhizal (AM) colonization, improving plant nutrition and growth. This difference highlights the evolutionary gap between legumes and non-legumes in their capacity for nodulation .

  • Expression of gofMtDMI3 in rice induces higher transcript levels of common symbiotic pathway (CSP) orthologues, including OsDMI3, OsIPD3, and OsNSP1, demonstrating its ability to activate the endogenous symbiotic program .

These findings suggest that while autoactive DMI3 is sufficient to trigger the complete nodulation pathway in legumes, additional genetic components may be needed to achieve similar developmental outcomes in non-legumes like rice.

What is the relationship between DMI3 and cytoskeletal reorganization during symbiotic interactions?

The establishment of symbiotic relationships requires significant cytoskeletal rearrangements. While DMI3 itself has not been directly linked to cytoskeletal reorganization in the search results, research on Medicago truncatula has revealed important connections between symbiotic signaling and microtubule (MT) dynamics:

  • Symbiotic signaling in M. truncatula requires repolarization of root hairs and rearrangement of cytoskeletal filaments .

  • The DEVELOPMENTALLY REGULATED PLASMA MEMBRANE POLYPEPTIDE (DREPP) protein in M. truncatula is involved in microtubule reorganization during rhizobial infections and affects nodulation .

  • DREPP relocalizes into symbiosis-specific membrane nanodomains in response to calcium and Nod factors, coinciding with microtubule fragmentation .

  • Mutants in the symbiotic signaling pathway, including dmi2 and dmi3-1, show altered DREPP expression patterns, suggesting a potential connection between DMI3 function and cytoskeletal dynamics .

These findings suggest that DMI3, as a central component of symbiotic signaling, likely influences cytoskeletal reorganization, possibly through intermediary proteins like DREPP, though the exact molecular mechanisms require further investigation.

How do phosphorylation sites in the calmodulin-binding domain affect DMI3 function?

Research on specific phosphorylation sites in the calmodulin-binding domain of DMI3 reveals their critical importance for proper function:

  • S344 phosphorylation site:

    • The phospho-ablative mutation S344A (preventing phosphorylation) does not significantly affect kinase activities and supports both root nodule symbiosis and arbuscular mycorrhizal symbiosis, indicating that phosphorylation at this position is not essential for establishing symbioses .

    • The phospho-mimic mutation S344D (mimicking constitutive phosphorylation) drastically reduces calmodulin-stimulated substrate phosphorylation, coinciding with compromised interaction with both calmodulin and its interacting partner, IPD3 .

This indicates that while S344 phosphorylation is not required for symbiosis establishment, constitutive phosphorylation at this site disrupts normal DMI3 function by interfering with key protein interactions necessary for signal transduction.

The regulatory mechanism involving S344 phosphorylation likely serves as a fine-tuning mechanism or potentially as a negative feedback loop to modulate DMI3 activity after initial activation. The selective pressure to maintain this phosphorylation site despite its non-essential nature for symbiosis suggests additional regulatory roles that may be context-dependent.

What techniques are available for studying DMI3 phosphorylation states?

Multiple techniques can be employed to study DMI3 phosphorylation states, each with specific advantages:

  • Phospho-ablative and phospho-mimic mutations: Creating specific mutations at phosphorylation sites (such as S344A and S344D) allows researchers to study the functional impacts of phosphorylation events. The S344A mutation prevents phosphorylation, while S344D mimics constitutive phosphorylation by introducing a negative charge at the site .

  • In vitro kinase assays: These assays can measure the autophosphorylation activity of recombinant DMI3 and its variants, as well as their ability to phosphorylate downstream substrates under various conditions (with/without calcium, calmodulin, etc.) .

  • Protein-protein interaction assays: Techniques such as yeast two-hybrid, co-immunoprecipitation, or bimolecular fluorescence complementation can assess how phosphorylation states affect interactions between DMI3 and its partners like calmodulin and IPD3 .

  • Mass spectrometry: This technique can identify phosphorylation sites and quantify phosphorylation levels under different conditions, providing comprehensive phosphorylation profiles of DMI3.

These methodologies complement each other and offer researchers a toolkit to dissect the complex regulatory mechanisms involving DMI3 phosphorylation in symbiotic signaling.

How can DMI3 function be studied in non-legume plants?

Studying DMI3 function in non-legume plants presents unique challenges and opportunities. Several methodological approaches have proven effective:

  • Heterologous expression of legume DMI3 variants: Expressing gain-of-function Medicago truncatula DMI3 variants (like gofMtDMI3) in non-legumes such as rice allows researchers to assess if legume-like symbiotic responses can be mimicked. This approach revealed that while gofMtDMI3 expression in rice didn't produce nodule-like structures, it supported elevated arbuscular mycorrhizal colonization and improved plant nutrition/growth .

  • Transcriptomic analysis: Assessing how heterologous DMI3 expression affects the transcription of endogenous symbiotic pathway genes in non-legumes. In rice, gofMtDMI3 expression induced higher transcript levels of CSP orthologues OsDMI3, OsIPD3, and OsNSP1 .

  • Functional complementation: Testing if non-legume DMI3 orthologs can complement legume dmi3 mutants provides insights into functional conservation.

  • Phylogenetic analysis: Comparing DMI3 sequences across diverse plant species helps identify conserved domains and potential functional adaptations in different lineages.

These approaches help researchers understand the evolutionary conservation of DMI3 function and the adaptations that may have enabled legumes to establish nitrogen-fixing symbioses.

What methods are effective for tissue-specific expression studies of DMI3?

Research has demonstrated effective methods for tissue-specific expression studies of DMI3, particularly for distinguishing epidermal versus cortical functions:

  • Tissue-specific promoters: Using promoters with known cell-type specificity to drive DMI3 expression in specific tissues. This approach allowed researchers to determine that epidermal DMI3 is sufficient for infection thread formation in root hairs, while DMI3 is required in both epidermal and cortical cell layers for nodule primordia formation .

  • Complementation of mutants with tissue-specific expression: Expressing DMI3 under tissue-specific promoters in dmi3 mutant backgrounds allows assessment of where DMI3 function is required for different symbiotic processes .

  • Reporter gene fusions: Fusing DMI3 to reporter genes like GFP or GUS under tissue-specific promoters enables visualization of expression patterns and protein localization.

This methodology has been crucial for understanding the cell-autonomous and non-cell-autonomous functions of DMI3, revealing that a signal produced in the epidermis under the control of NFP and DMI3 is responsible for activating DMI3 in the cortex to trigger nodule organogenesis .

How can autoactive variants of DMI3 be created and validated?

Creating and validating autoactive variants of DMI3 involves several key methodological steps:

  • Site-directed mutagenesis: Specific mutations can be introduced to create constitutively active DMI3 variants. The T271D mutation in Medicago truncatula DMI3 creates a gain-of-function variant that activates downstream signaling without requiring upstream calcium signals .

  • Expression verification: Confirming proper expression of the autoactive variant using techniques like RT-qPCR, Western blotting, or fluorescent protein tagging.

  • Functional validation in legumes: Testing the ability of the autoactive variant to induce spontaneous nodulation in legumes in the absence of rhizobia. The gofMtDMI3 variant induced spontaneous nodule formation in common bean, confirming its autoactive function .

  • Cross-species functional analysis: Expressing the autoactive variant in non-legumes like rice to assess its effects on symbiotic processes such as mycorrhizal colonization .

  • Transcriptional analysis: Analyzing changes in the expression of downstream genes to confirm pathway activation. In rice, gofMtDMI3 expression induced higher transcript levels of symbiotic pathway orthologues .

These methodologies provide robust validation of autoactive DMI3 variants and their utility as tools to study symbiotic signaling pathways across different plant species.

How does DMI3 function differ between legumes and non-legumes?

DMI3 shows both conservation and divergence between legumes and non-legumes:

AspectLegumes (e.g., Medicago truncatula)Non-legumes (e.g., Rice)
Basic functionRequired for both nodulation and mycorrhizationRequired for mycorrhization only
Response to autoactive DMI3Induces spontaneous nodulationEnhances mycorrhizal colonization without nodule-like structures
Downstream responsesActivates both nodulation and mycorrhization pathwaysActivates mycorrhization pathway only
Genetic contextFunctions with specialized nodulation-specific genesLacks some nodulation-specific genetic components

When expressed in rice, a gain-of-function Medicago truncatula DMI3 variant (gofMtDMI3) did not produce legume-like nodular manifestations but supported elevated arbuscular mycorrhizal colonization that improved plant nutrition and growth . This indicates that while the basic function of DMI3 in mycorrhizal symbiosis is conserved across plant lineages, additional genetic components present in legumes are required for nodulation.

What role does DMI3 play in coordinating epidermal and cortical responses during symbiosis?

DMI3 plays a sophisticated role in coordinating responses across different root tissues during symbiotic interactions:

  • Epidermal function: Epidermal DMI3 is sufficient for infection thread formation in root hairs, the structures through which rhizobia enter the plant .

  • Cortical requirement: DMI3 is required in both epidermal and cortical cell layers for nodule primordia formation, indicating that it has cell-autonomous functions in the cortex .

  • Signal transduction between tissues: Research suggests that a signal, produced in the epidermis under the control of NFP (a symbiotic receptor) and DMI3, is responsible for activating DMI3 in the cortex to trigger nodule organogenesis .

This tissue-specific analysis reveals that DMI3 functions as part of a sophisticated signaling relay that coordinates bacterial entry at the epidermis with nodule development in the underlying cortical tissues. This coordination ensures that nodule development occurs in concert with bacterial infection, optimizing the symbiotic relationship.

How do DMIs contribute to understanding genetic incompatibilities in hybrid populations?

The term "DMI" in the context of genetic incompatibilities refers to Dobzhansky-Muller Incompatibilities, which are different from the "Does not Make Infections" genes in Medicago truncatula, but the research methodologies overlap:

  • Statistical approaches: A statistic called X(2) has been developed to identify DMIs (Dobzhansky-Muller Incompatibilities) by measuring reduced variance in two-locus heterozygosity. This approach distinguishes genetic associations arising due to physical linkage from those arising due to gene interactions .

  • Application to hybrid populations: When applied to three hybrid populations of swordtail fish, this approach confirmed previously known DMIs and identified new candidate incompatibilities .

  • Relevance to plant systems: Similar approaches could potentially be applied to study genetic incompatibilities in plant hybrid populations, including those involving symbiotic genes like the DMI (Does not Make Infections) genes.

Understanding the genetic basis of incompatibilities is crucial for breeding programs and evolutionary studies, particularly when trying to transfer symbiotic traits between species or understand the evolution of symbiotic capabilities across plant lineages.

What are the prospects for transferring nodulation capability to non-legumes using DMI3 engineering?

The potential for transferring nodulation capability to non-legumes using DMI3 engineering presents both promising opportunities and significant challenges:

  • Current progress: Expression of gain-of-function Medicago truncatula DMI3 (gofMtDMI3) in rice improved arbuscular mycorrhizal colonization but did not induce nodule-like structures, indicating that DMI3 activation alone is insufficient for nodulation in non-legumes .

  • Required additional components: The absence of nodule-like structures in rice expressing gofMtDMI3 suggests that additional genetic components beyond DMI3 activation are needed to establish nitrogen-fixing symbioses in non-legumes .

  • Transcriptional effects: The finding that gofMtDMI3 expression in rice induced higher transcript levels of CSP orthologues (OsDMI3, OsIPD3, and OsNSP1) indicates that DMI3 engineering can positively influence the expression of symbiotic pathway genes in non-legumes .

  • Agricultural potential: Successfully transferring nodulation capability to cereal crops like rice could dramatically reduce reliance on synthetic nitrogen fertilizers, addressing both economic and ecological costs of current agricultural practices .

Future research should focus on identifying the complete set of genetic components required for nodulation beyond DMI3 and developing strategies to engineer these components into non-legume crops in a coordinated manner.

What are the remaining unknowns about DMI3 regulation and function?

Despite significant advances in understanding DMI3, several important questions remain:

  • Complete phosphorylation profile: While the role of S344 phosphorylation has been investigated, a comprehensive map of all phosphorylation sites and their functions remains to be established .

  • Structural dynamics: Detailed structural studies of how calcium binding, autophosphorylation, and calmodulin binding change DMI3 conformation are needed.

  • Specificity mechanisms: How DMI3 distinguishes between mycorrhizal and rhizobial symbiotic signals to activate appropriate downstream pathways remains poorly understood.

  • Temporal regulation: The dynamics of DMI3 activation and deactivation during the establishment and maintenance of symbioses need further investigation.

  • Non-symbiotic functions: Potential roles of DMI3 in other aspects of plant development and stress responses remain to be explored.

Addressing these unknowns will require integrating structural biology, biochemistry, genetics, and systems biology approaches to build a complete model of DMI3 function in plant symbioses and beyond.

How might DMI3 research contribute to sustainable agriculture practices?

DMI3 research has significant potential to contribute to sustainable agriculture practices:

  • Reduced fertilizer dependence: Understanding and potentially transferring nodulation capability to non-legumes could significantly reduce reliance on synthetic nitrogen fertilizers, addressing both economic costs and environmental concerns such as water pollution and greenhouse gas emissions .

  • Enhanced mycorrhizal associations: The finding that gofMtDMI3 expression in rice supported elevated arbuscular mycorrhizal colonization suggests potential applications for enhancing beneficial fungal associations in crop plants, improving nutrient uptake efficiency and drought tolerance .

  • Crop improvement strategies: Knowledge of DMI3 function and regulation can inform breeding strategies to optimize symbiotic capabilities in existing legume crops.

  • Biofertilizer development: Understanding the molecular mechanisms of symbiotic interactions mediated by DMI3 can guide the development of more effective biofertilizers and microbial inoculants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.