Recombinant Megalops atlanticus Cytochrome b (mt-cyb)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant mt-cyb is synthesized using heterologous expression systems, with variations in host organisms and tags influencing yield and functionality .

Host SystemAdvantagesLimitations
E. coliHigh yield, low cost, rapid production .Lacks post-translational modifications.
YeastSimilar to E. coli, suitable for basic studies .Limited scalability compared to E. coli.
Insect CellsProper folding and disulfide bond formation .High cost, complex protocols.
Mammalian CellsNative-like modifications (e.g., glycosylation) .Low yield, time-intensive.

Key Production Parameters:

  • Purity: >85–90% (SDS-PAGE) .

  • Tags: N-terminal His-tag for affinity chromatography .

  • Expression Region: Full-length (1–102 aa) or partial sequences .

Biochemical Studies

  • ELISA Development: Used as an antigen in enzyme-linked immunosorbent assays to detect anti-cytochrome b antibodies .

  • Complex III Reconstitution: Studied in vitro to elucidate electron transfer mechanisms .

Disease Modeling

  • Mitochondrial Disorders: Mutations in mt-cyb (e.g., m.14757T>C, m.14864T>C) are linked to complex III deficiency, causing myopathy, cardiomyopathy, and MELAS-like symptoms .

  • Pathogenic Mechanisms:

    • G251D Mutation: Disrupts cytochrome b assembly, leading to histiocytoid cardiomyopathy .

    • M4T Mutation: Reduces complex III activity, associated with dilated cardiomyopathy .

Genetic Research

  • Genetic Sequencing: Analyzed via PCR amplification of mtDNA regions (e.g., 14747–15887) .

  • Heteroplasmy Studies: Mutant mtDNA load correlates with tissue-specific pathology (e.g., skeletal muscle) .

Disease Associations

DisorderMutationClinical FeaturesReferences
Complex III Deficiencymt-cyb mutationsMyopathy, lactic acidosis, exercise intolerance
Dilated Cardiomyopathym.14757T>C (M4T)Reduced complex III activity, heart failure
MELAS-Like Syndromem.14864T>C (C40R)Strokelike episodes, epilepsy, sensorimotor neuropathy

Diagnostic Challenges

  • Heteroplasmy: Variable mutant mtDNA loads across tissues complicate diagnosis .

  • Biochemical Workup: OXPHOS enzyme activity assays in muscle biopsies are critical .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-cyb; cob; cytb; mtcyb; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Megalops atlanticus (Tarpon) (Clupea gigantea)
Target Names
Target Protein Sequence
FGSLLGLCLATQILTGLFLAMHYTSDISTAFSSVTHICRDVNYGWLIRNIHANGASFFFI CIYLHIGRGLYYGSYLYKETWNIGVVLLLLVMMTAFVGYVLP
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is then used for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Megalops atlanticus cytochrome b and what are its primary functions?

Megalops atlanticus cytochrome b is a mitochondrial protein encoded by the MT-CYB gene in Atlantic tarpon. It functions as a critical component of the respiratory chain complex III (cytochrome bc1 complex), where it catalyzes electron transfer from ubiquinol to cytochrome c during oxidative phosphorylation. This process is essential for cellular ATP production. The protein contains multiple transmembrane domains and binding sites for heme groups, which are crucial for its electron transport function . Similar to other cytochrome b proteins, it likely plays a vital role in the mitochondrial respiratory chain of Atlantic tarpon, contributing to energy production in this species that undertakes long spawning migrations.

How does the sequence of Megalops atlanticus cytochrome b compare to other fish species?

Megalops atlanticus cytochrome b shows varying degrees of conservation when compared to other fish species. While the functional domains involved in electron transport and heme binding tend to be highly conserved across species, the variable regions of the sequence provide valuable information for phylogenetic studies. Researchers typically observe conservation patterns consistent with evolutionary relationships, with greater sequence similarity between Megalops atlanticus and other members of the Elopomorpha superorder.

For maximum research utility, sequence alignments should be performed using MUSCLE or CLUSTAL algorithms, followed by calculation of percent identity and similarity. Conserved regions can be identified using motif-finding tools such as MEME Suite, with special attention to the regions encoding the Qo and Qi binding sites that are critical for ubiquinone interactions.

What are the optimal methods for isolating mtDNA from Megalops atlanticus tissue samples?

For successful isolation of mtDNA from Megalops atlanticus tissue samples, researchers should:

  • Collect fresh muscle tissue (preferably red muscle with high mitochondrial content) and immediately preserve in 95% ethanol or flash-freeze in liquid nitrogen.

  • Homogenize 50-100 mg of tissue in isolation buffer (10 mM Tris-HCl, 150 mM NaCl, 10 mM EDTA, pH 8.0).

  • Perform differential centrifugation to isolate mitochondria (1,000×g for 10 minutes to remove nuclei, followed by 10,000×g for 15 minutes to pellet mitochondria).

  • Extract mtDNA using a standard phenol-chloroform method or commercial kits optimized for mtDNA isolation.

  • Verify mtDNA quality through gel electrophoresis and spectrophotometric analysis.

When working with degraded or preserved museum specimens, researchers should modify protocols to include carrier RNA and extended digestion times with proteinase K. PCR amplification of the MT-CYB gene can be facilitated using conserved primers designed from aligned fish cytochrome b sequences .

What expression systems are most suitable for producing functional recombinant Megalops atlanticus cytochrome b?

Selection of an appropriate expression system for recombinant Megalops atlanticus cytochrome b requires careful consideration of protein characteristics:

Expression SystemAdvantagesLimitationsRecommendations for mt-cyb
E. coliHigh yield, low cost, rapid growthLimited post-translational modifications, inclusion body formationSuitable with fusion tags (MBP, SUMO); requires membrane-targeting sequences
Yeast (P. pastoris)Eukaryotic PTMs, high density culturesLonger expression timeExcellent for functional mt-cyb due to mitochondrial machinery
Insect cellsComplex eukaryotic PTMs, membrane protein expressionHigher cost, technically demandingIdeal for structural studies requiring native conformation
Cell-free systemsMembrane protein compatibility, rapid productionLower yield, high costUseful for preliminary functional studies

For optimal results with recombinant Megalops atlanticus cytochrome b, a eukaryotic expression system is generally preferred due to the membrane-associated nature of the protein and its requirement for proper incorporation of heme groups. Codon optimization for the selected expression system is critical, as is the inclusion of appropriate targeting sequences to ensure proper localization to membranes .

How can researchers address the challenge of properly folding recombinant cytochrome b proteins?

Proper folding of recombinant Megalops atlanticus cytochrome b presents significant challenges due to its hydrophobic nature and requirement for heme incorporation. Researchers should implement the following strategies:

  • Co-express with chaperone proteins (Hsp60, Hsp70) to facilitate proper folding.

  • Include heme precursors (δ-aminolevulinic acid) in the culture medium to ensure sufficient heme availability.

  • Utilize solubility-enhancing fusion partners such as MBP, SUMO, or thioredoxin.

  • Implement controlled expression conditions (reduced temperature of 16-20°C, low inducer concentrations).

  • Consider membrane-mimetic environments during purification (detergents such as DDM, CHAPS, or reconstitution into nanodiscs).

Verification of proper folding can be assessed through spectroscopic methods examining the characteristic absorption spectra of heme groups, with properly folded cytochrome b exhibiting distinct absorption peaks at approximately 414 nm (Soret band) and 562-566 nm (α-band) when reduced. Circular dichroism spectroscopy can further confirm secondary structure elements expected in a properly folded protein .

What are the established protocols for site-directed mutagenesis studies of functional domains in Megalops atlanticus cytochrome b?

Site-directed mutagenesis provides valuable insights into structure-function relationships in Megalops atlanticus cytochrome b. Based on structural similarities with characterized cytochrome b proteins, researchers should target:

  • Conserved histidine residues involved in heme coordination

  • Residues in the Qo and Qi binding pockets that interact with ubiquinone

  • Transmembrane helices that contribute to protein stability

A recommended protocol involves:

  • Design primers containing the desired mutation with 15-20 complementary nucleotides on either side of the mutation site.

  • Perform PCR using a high-fidelity DNA polymerase with the MT-CYB gene cloned into a suitable expression vector as template.

  • Digest the PCR product with DpnI to remove methylated template DNA.

  • Transform into competent E. coli cells and select transformants.

  • Verify mutations by sequencing.

  • Express and purify mutant proteins using the same conditions as wild-type.

Functional characterization should compare enzymatic activities, spectroscopic properties, and stability between wild-type and mutant proteins. Electron transfer activity can be assessed using artificial electron donors/acceptors like ubiquinol and cytochrome c in reconstituted systems .

How can phylogenetic analysis utilizing Megalops atlanticus cytochrome b sequences inform evolutionary studies?

MT-CYB is widely used in phylogenetic studies due to its moderate rate of sequence evolution. For Megalops atlanticus, cytochrome b sequence analysis can:

  • Clarify evolutionary relationships within Elopomorpha and related teleost lineages

  • Assess genetic diversity within Atlantic tarpon populations

  • Provide molecular clock estimates for divergence times

  • Identify signatures of selection in different environmental contexts

Methodologically, researchers should:

  • Amplify and sequence the complete MT-CYB gene (approximately 1140 bp) from multiple specimens representing different populations.

  • Align sequences with homologs from related species using MUSCLE or CLUSTAL.

  • Perform model testing to identify the most appropriate evolutionary model.

  • Construct phylogenetic trees using maximum likelihood, Bayesian inference, or neighbor-joining methods.

  • Assess node support through bootstrap analysis or posterior probabilities.

Population genetic analyses can utilize the polymorphic nature of cytochrome b to assess genetic differentiation between tarpon populations . This approach complements microsatellite marker studies, which have already demonstrated their utility in Atlantic tarpon genetic research.

What purification strategies yield the highest purity and activity for recombinant Megalops atlanticus cytochrome b?

Purification of recombinant Megalops atlanticus cytochrome b requires specialized approaches due to its membrane-associated nature:

  • Membrane Preparation: After cell lysis, differential centrifugation (10,000×g followed by 100,000×g) effectively isolates membrane fractions containing the expressed protein.

  • Detergent Solubilization: Mild detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% effectively solubilize the protein while maintaining activity. Initial screening of multiple detergents is recommended to identify optimal conditions.

  • Affinity Chromatography: His-tagged constructs can be purified using Ni-NTA resins with imidazole gradients (20-250 mM). Buffer composition should include:

    • 50 mM phosphate buffer or Tris-HCl (pH 7.5-8.0)

    • 300 mM NaCl

    • 0.1-0.2% detergent (DDM)

    • 10% glycerol as stabilizer

    • 1 mM PMSF or protease inhibitor cocktail

  • Size-Exclusion Chromatography: A final polishing step using Superdex 200 separates aggregates and provides buffer exchange.

  • Reconstitution: For functional studies, reconstitution into proteoliposomes or nanodiscs preserves activity better than detergent micelles.

Purity should be assessed by SDS-PAGE (>90% homogeneity) and spectroscopic analysis to verify heme incorporation .

How can researchers differentiate between sequence variations and potential DNA damage in MT-CYB amplified from archived Megalops atlanticus specimens?

When working with archived or museum specimens of Megalops atlanticus, researchers must distinguish between genuine sequence polymorphisms and artifacts resulting from DNA damage. This differentiation is critical for accurate phylogenetic or population genetic analyses.

Recommended approaches include:

  • Multiple Independent Amplifications: Perform at least three separate PCR reactions from the same extract to identify consistent sequence variations.

  • Bidirectional Sequencing: Sequence both strands to confirm variations.

  • Fragment Analysis: Compare short overlapping fragments to identify damage-prone regions.

  • Damage Patterns Analysis: Post-mortem DNA damage typically shows C→T and G→A transitions due to cytosine deamination. Statistical analyses of substitution patterns can identify these signatures.

  • Next-Generation Sequencing: Deep sequencing provides coverage depth that can distinguish low-frequency artifacts from true variants.

  • Authentication Criteria:

    • Reproducibility across multiple PCRs

    • Biological plausibility of observed variations

    • Consistency with expected phylogenetic patterns

    • Absence of damage-associated substitution patterns

For highly degraded samples, researchers should consider using specialized polymerases with proofreading activity and damage repair capabilities, such as KAPA HiFi or Q5 .

What spectroscopic methods are most informative for characterizing the functional properties of recombinant Megalops atlanticus cytochrome b?

Spectroscopic techniques provide essential information about the structural integrity and functional properties of recombinant cytochrome b:

TechniqueInformation ProvidedExperimental ConditionsAnalysis Parameters
UV-Visible SpectroscopyHeme incorporation, redox state300-700 nm scan of oxidized/reduced samplesSoret peak (~414 nm), α/β bands (562-566 nm)
Circular DichroismSecondary structure elementsFar-UV (190-250 nm) for 2° structure; Near-UV for tertiaryα-helical content (common in mt-cyb)
Electron Paramagnetic ResonanceHeme environment, spin statesLow temperature (4-77K), varying microwave powerg-values characteristic of b-type cytochromes
Resonance RamanHeme-protein interactionsExcitation at Soret maximum (~414 nm)Vibrational modes of heme and protein
FTIRSecondary structure, membrane incorporationAttenuated total reflection modeAmide I/II bands (1700-1600 cm⁻¹)

For redox potential determination, potentiometric titrations using mediators such as diaminodurene, phenazine methosulfate, and potassium ferricyanide should be performed while monitoring spectral changes. The midpoint potential (Em) can be calculated from the Nernst equation, providing insights into the protein's functional properties in electron transfer reactions .

How can researchers resolve contradictory results between in vitro studies of recombinant Megalops atlanticus cytochrome b and in vivo observations?

Discrepancies between in vitro characterization of recombinant cytochrome b and in vivo observations in Megalops atlanticus can arise from multiple sources. Researchers should systematically address these contradictions through:

  • Expression System Evaluation: Compare properties of the recombinant protein expressed in different systems (bacterial, yeast, insect cells) to identify system-specific artifacts.

  • Post-translational Modification Analysis: Use mass spectrometry to identify any PTMs present in native but not recombinant protein, particularly focusing on:

    • Phosphorylation sites

    • Lipid modifications

    • Proteolytic processing

  • Protein-Protein Interaction Studies: Investigate whether in vivo activity depends on interactions with other complex III components not present in recombinant studies. Co-immunoprecipitation from native tissues can identify these partners.

  • Functional Context Reconstitution: Progressively increase system complexity from:

    • Isolated protein → Proteoliposomes → Membrane fragments → Isolated mitochondria

  • Environmental Parameter Screening: Systematically vary experimental conditions (pH, ionic strength, temperature) to identify factors affecting protein behavior.

When contradictions persist, researchers should consider developing transgenic models expressing tagged versions of the protein for in situ studies, or using native tissue samples for direct biochemical analysis .

What bioinformatic approaches are most effective for analyzing evolutionary patterns in Megalops atlanticus cytochrome b compared to other species?

Analyzing evolutionary patterns in Megalops atlanticus cytochrome b requires sophisticated bioinformatic approaches:

  • Sequence Analysis Pipeline:

    • Multiple sequence alignment with MUSCLE or CLUSTAL Omega

    • Model testing using ModelTest or jModelTest to identify appropriate evolutionary models

    • Phylogenetic tree construction (Maximum Likelihood, Bayesian, Neighbor-Joining)

    • Tree visualization and annotation using FigTree or iTOL

  • Selection Analysis:

    • Site-specific selection using PAML or HyPhy (dN/dS ratios)

    • Branch-site tests to identify lineage-specific selection

    • MEME analysis for episodic selection

    • TreeSAAP for analysis of physicochemical property changes

  • Structural Analysis Integration:

    • Homology modeling based on resolved cytochrome b structures

    • Mapping of variable/conserved regions onto 3D models

    • Correlation of functional domains with selection patterns

  • Population Genetics Methods (for intraspecific analysis):

    • Haplotype network construction

    • Neutrality tests (Tajima's D, Fu's Fs)

    • Mismatch distribution analysis

    • Bayesian skyline plot for demographic history

These methods should be integrated to develop a comprehensive understanding of how evolutionary forces have shaped cytochrome b in Megalops atlanticus relative to related species . Special attention should be paid to sites involved in thermal adaptation, as Atlantic tarpon inhabit waters with varying temperature regimes.

How can isotope labeling enhance structural studies of recombinant Megalops atlanticus cytochrome b?

Isotope labeling significantly enhances structural characterization of membrane proteins like cytochrome b through nuclear magnetic resonance (NMR) spectroscopy and other techniques. Researchers studying Megalops atlanticus cytochrome b should consider the following approaches:

  • Uniform Labeling Strategies:

    • ¹⁵N labeling for backbone assignment using NH-HSQC experiments

    • ¹³C/¹⁵N double labeling for complete resonance assignment

    • ²H labeling to reduce spectral complexity and improve relaxation properties

  • Selective Labeling Approaches:

    • Amino acid-specific labeling (particularly histidines involved in heme coordination)

    • Segmental labeling for specific domains

    • Methyl-group labeling (Ile, Leu, Val) for studying dynamics in large proteins

  • Special Considerations for Expression:

    • Minimal media supplemented with labeled precursors

    • Adaptation of expression host to minimal media conditions

    • Optimization of induction parameters for labeled media

  • Analytical Applications:

    • Solution NMR for flexible regions and protein dynamics

    • Solid-state NMR for membrane-embedded regions

    • Paramagnetic relaxation enhancement to probe distances between labeled sites

    • Hydrogen/deuterium exchange for solvent accessibility

When combined with complementary techniques like cryo-electron microscopy, isotope labeling provides unprecedented insights into protein structure-function relationships, allowing researchers to map electron transfer pathways and identify critical residues involved in protein-protein interactions within the respiratory complex .

How might CRISPR/Cas9 technology be applied to study MT-CYB function in Megalops atlanticus?

CRISPR/Cas9 technology offers powerful approaches for investigating MT-CYB function in Megalops atlanticus, despite the challenges of working with mitochondrial DNA and a non-model organism:

  • Nuclear Expression of Mitochondrial Genes:

    • Engineer nuclear-encoded, mitochondrially-targeted MT-CYB with appropriate modifications

    • Create CRISPR-mediated knockins or knockouts in cultured tarpon cells

    • Analyze effects on respiratory chain assembly and function

  • Mitochondrial Base Editors:

    • Utilize DddA-derived cytosine base editors (DdCBEs) that can access mtDNA

    • Target specific nucleotides in MT-CYB to create precise mutations

    • Assess phenotypic consequences in cellular models

  • In Vitro Mtochondrial Import Assays:

    • Express wild-type and mutant versions of tarpon MT-CYB

    • Study import efficiency and membrane integration

    • Analyze complex assembly using blue native electrophoresis

  • Comparative Studies Using Model Organisms:

    • Create equivalent mutations in zebrafish or medaka cytochrome b

    • Analyze conservation of function across species

    • Extrapolate findings to understand tarpon biology

These approaches can address fundamental questions about cytochrome b function, particularly regarding:

  • The role of specific amino acid residues in ubiquinone binding

  • Heme coordination structures

  • Inter-subunit interactions within complex III

  • Species-specific adaptations in electron transport

Considerations for deletion mutations should reflect the findings from human MT-CYB deletions, where even small in-frame deletions can cause significant functional defects in complex III assembly and activity .

What insights might comparative analysis of Megalops atlanticus cytochrome b provide regarding adaptation to different aquatic environments?

Comparative analysis of cytochrome b across Megalops atlanticus populations from different habitats offers unique insights into molecular adaptation to varying environmental conditions:

  • Thermal Adaptation Signatures:

    • Sequence comparison between populations from tropical vs. subtropical waters

    • Identification of amino acid substitutions affecting protein flexibility or stability

    • Correlation of variants with local temperature profiles

  • Salinity Tolerance Mechanisms:

    • Analysis of cytochrome b sequences from specimens in different salinity regimes

    • Investigation of potential impacts on proton pumping efficiency

    • Comparison with euryhaline vs. stenohaline related species

  • Methodological Approach:

    • Population sampling across environmental gradients

    • Complete MT-CYB sequencing from multiple individuals per population

    • Biochemical characterization of variants (expression, stability, activity)

    • Molecular dynamics simulations to predict functional impacts

  • Integration with Ecological Data:

    • Correlation of genetic variation with migration patterns

    • Analysis of spawning site preferences in relation to genotypes

    • Investigation of potential local adaptation vs. phenotypic plasticity

This research direction is particularly relevant given that Atlantic tarpon undertake extensive spawning migrations across varying environmental conditions, potentially subjecting mitochondrial function to different selective pressures . The high polymorphism observed in Megalops atlanticus populations suggests potential adaptive variation that could be correlated with environmental factors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.