Recombinant Meleagris gallopavo Beta-4C adrenergic receptor (ADRB4C)
Shipped with Ice Packs 
In Stock 
Description
Physicochemical Properties
Functional Insights
ADRB4C belongs to the G protein-coupled receptor (GPCR) family, mediating catecholamine responses. While its exact physiological role in turkeys remains understudied, transcriptomic data associate it with neural and metabolic pathways . Comparative studies suggest functional parallels with mammalian β-adrenergic receptors, such as:
Key Production Metrics
| Parameter | Specification |
|---|---|
| Host System | E. coli |
| Tag | N-terminal His tag (10xHis) |
| Yield | Optimized for 50 µg batches; scalable to larger sizes |
| Stability | 12 months (lyophilized); 6 months (liquid) |
Quality Assurance:
Comparative Analysis with Other Adrenergic Receptors
Research Applications
-
Structural Studies: Used in crystallography and cryo-EM to map GPCR architectures .
-
Ligand Screening: Facilitates drug discovery for avian-specific adrenergic modulators .
-
Comparative Physiology: Clarifies evolutionary divergence in adrenergic signaling .
Limitations and Future Directions
Current research gaps include:
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
ADRB4C; Beta-4C adrenergic receptor; Beta-4C adrenoreceptor; Beta-4C adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Meleagris gallopavo (Wild turkey)
Target Names
ADRB4C
Target Protein Sequence
MTPLPAGNGSVPNCSWAAVLSRQWAVGAALSITILVIVAGNLLVIVAIAKTPRLQTMTNV
FVTSLACADLVMGLLVVPPGATILLSGHWPYGTVVCELWTSLDVLCVTASIETLCAIAVD
RYLAITAPLQYEALVTKGRAWAVVCMVWAISAFISFLPIMNHWWRDGADEQAVRCYDDPR
CCDFVTNMTYAIVSSTVSFYVPLLVMIFVYVRVFAVATRHVQLIGKDKVRFLQENPSLSS
RGGRWRRPSRLLAIKEHKALKTLGIIMGTFTLCWLPFFVANIIKVFCRPLVPDQLFLFLN
WLGYVNSAFNPIIYCRSPDFRSAFRKLLCCPRRADRRLHAAPQDPQHCSCAFSPRGDPME
DSKAVDPGHLREDSEVQGSGRREENASSHGGGHQQRPLGECWLQGMQSMLCEQLDEFTST
EMPAGPSV
Uniprot No.
Target Background
Function
Beta-adrenergic receptors mediate the activation of adenylate cyclase by catecholamines through the action of G proteins.
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB4C sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Broad tissue distribution.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
