Recombinant Meleagris gallopavo D (2) dopamine receptor

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Meleagris gallopavo D (2) dopamine receptor (DRD2) is a genetically engineered protein derived from the domestic turkey (Meleagris gallopavo). As a member of the G protein-coupled receptor (GPCR) family, it plays critical roles in dopamine-mediated signaling, influencing motor control, cognition, and neuroendocrine regulation in avian species . This recombinant protein serves as a vital tool for studying dopamine receptor evolution, ligand interactions, and neuropharmacology in birds .

Production and Purification

Key Protocols

  • Cloning: Reverse transcriptase-polymerase chain reaction (RT-PCR) and rapid amplification of cDNA ends (RACE) were used to isolate the DRD2 gene from turkey brain mRNA .

  • Purification: Achieved via SDS-PAGE, with ≥85% purity .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C or -80°C .

Amino Acid Sequence
The full-length protein (Uniprot: O73810) includes residues 1–436, with critical domains for dopamine binding and G protein coupling .

Tissue Distribution and Isoforms

  • mRNA Expression: A 2.4-kb transcript is widely distributed in the turkey brain (telencephalon, cerebellum, pituitary) and peripheral tissues .

  • Splicing Variants: An alternatively spliced short isoform (D2S) was identified, similar to mammalian D2 receptors .

Functional Insights

  • Evolutionary Conservation: The turkey DRD2 shares high homology with mammalian D2 receptors, supporting its role in conserved dopaminergic pathways .

  • Neuromodulatory Role: Regulates adenylate cyclase inhibition, impacting cyclic AMP (cAMP) levels and protein kinase A (PKA) activity .

Comparative Studies

  • Avian vs. Mammalian Receptors: While structurally homologous, avian DRD2 exhibits unique expression patterns in the pineal gland and pituitary, suggesting species-specific regulatory functions .

Applications in Research

  1. Neurobiological Studies: Used to map dopamine receptor distribution in avian brains .

  2. Drug Development: Serves as a model for testing antipsychotics and Parkinson’s disease therapeutics targeting D2 receptors .

  3. Evolutionary Biology: Highlights lineage-specific adaptations in dopamine receptor function across vertebrates .

Table 1: Key Physicochemical Properties

PropertyDetail
Molecular Weight~50 kDa (predicted)
Isoelectric PointNot reported
TagDetermined during production
Binding AffinityDopamine (Kd values pending validation)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DRD2; D(2 dopamine receptor; Dopamine D2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Meleagris gallopavo (Wild turkey)
Target Names
Target Protein Sequence
MDPLNLSWYNTGDRNWSEPVNESSADQKPQYNYYAVLLTLLIFVIVFGNVLVCMAVSREK ALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSRIHCDIFVTLDVMMCTASIL NLCAISIDRYTAAAMPMLYNTRYSSKRRVTVMIACVWVLSFAISSPILFGLNKADERECI IANPAFVVYSSVVSFYVPFIVTLLVYVQIYMVLRRRRKRHTKRSSHGLDSDTHAPLKDKC THPENVKLGTVIVKSNGSFQVNKRKCEAESHIKMEMEMMSSTSPPERTIVKAAAPSNHQL VVPVASSRSTLDSPGKVEKNGHAKENLHTAKVFEIQSMPNGKTRSTLLKAMNRRKLSQQK EKKATQMLAIVLGVFIICWLPFFITHILNMHCDCNIPPAMYSAFTWLGYVNSAVNPIIYT TFNIEFRKAFMKILHC
Uniprot No.

Target Background

Function
This dopamine receptor functions through G proteins, which inhibit adenylyl cyclase. It positively regulates the postnatal regression of retinal hyaloid vessels by suppressing VEGFR2/KDR activity downstream of OPN5.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the Meleagris gallopavo D(2) dopamine receptor?

The Meleagris gallopavo D(2) dopamine receptor (DRD2) is a G protein-coupled receptor from wild turkey that mediates the effects of the neurotransmitter dopamine. This receptor contains seven transmembrane-spanning domains and belongs to the D2-like family of dopamine receptors. The receptor was cloned using reverse transcriptase-polymerase chain reaction (RT-PCR) in combination with 5' and 3' rapid amplification of cDNA ends (RACE), revealing a cDNA clone with an open reading frame of 1,311 base pairs encoding a 436-residue protein that exhibits high homology with previously cloned mammalian D2 dopamine receptors . Northern blot analysis detected an approximate 2.4-kb transcript in turkey brain, confirming its expression and size .

How conserved is the turkey D(2) dopamine receptor across species?

The turkey D(2) dopamine receptor demonstrates remarkable evolutionary conservation across vertebrate species. Comparative analysis reveals high sequence homology in a region that is highly conserved across species including Cercopithecus aethiops (green monkey), Mus musculus (mouse), Rattus norvegicus (rat), Bos taurus (cattle), and even Xenopus laevis (African clawed frog) . This extensive conservation, particularly within transmembrane domains, indicates the fundamental importance of the D2 receptor's structure and function throughout vertebrate evolution. The conservation is especially pronounced in regions critical for ligand binding and G protein coupling, suggesting preserved functional mechanisms across diverse species .

What expression systems are used for recombinant production of this receptor?

Multiple expression systems can be employed for the recombinant production of the Meleagris gallopavo D(2) dopamine receptor:

Expression SystemAdvantagesCommon Applications
E. coliHigh yield, cost-effective, rapid productionStructural studies, antibody production
YeastPost-translational modifications, proper foldingFunctional studies, high-throughput screening
BaculovirusAdvanced eukaryotic processing, high expressionReceptor binding assays, structural biology
Mammalian CellNative-like modifications, proper folding and traffickingFunctional assays, drug discovery

The commercial production typically employs E. coli systems for cost-effective production, with purification facilitated by affinity tags such as N-terminal His tags . The expression system should be selected based on the specific research requirements and downstream applications. For applications requiring functional receptors with native-like properties, eukaryotic expression systems may be preferable despite their higher cost and complexity .

What is the tissue distribution of the D(2) receptor in Meleagris gallopavo?

The D(2) dopamine receptor exhibits widespread distribution throughout the turkey brain and in select peripheral tissues. RT-PCR experiments have demonstrated that alternatively spliced D2 dopamine receptor transcripts are extensively distributed throughout various regions of the turkey brain . In situ hybridization experiments detected strong autoradiographic signals in multiple brain regions including:

  • Telencephalon

  • Diencephalon

  • Mesencephalon

  • Cerebellum

  • Pituitary gland

  • Pineal gland

This extensive distribution pattern suggests that dopamine signaling via D2 receptors likely has important functions in various physiological and behavioral processes in birds, similar to its diverse roles in mammals . The presence of D2 receptors in both the pituitary and pineal glands suggests involvement in neuroendocrine regulation and circadian processes, paralleling mammalian dopaminergic function.

What alternative splicing patterns are observed in the turkey DRD2 gene?

RT-PCR and subsequent nucleotide sequence analysis of turkey brain and peripheral tissue mRNA have demonstrated the presence of alternatively spliced mRNA corresponding to the predicted D2 short isoform . This finding parallels the alternative splicing patterns observed in mammalian D2 receptors, which produce long (D2L) and short (D2S) isoforms with distinct functional properties. The alternatively spliced D2 dopamine receptor transcripts were found to be widely distributed throughout the turkey brain and in select peripheral tissues, suggesting differential expression patterns that may reflect tissue-specific functional requirements .

The presence of these splice variants in the turkey DRD2 implies evolutionary conservation of this regulatory mechanism across vertebrate species. This alternative splicing likely contributes to the functional diversity of dopaminergic signaling in avian species, allowing for fine-tuning of receptor properties and signaling outcomes in different neural circuits and tissues.

What are the structural features of the ligand binding domain in the turkey D(2) receptor?

While the search results don't provide turkey-specific binding site information, structural analyses of dopamine receptors generally indicate that agonist binding occurs within the hydrophobic transmembrane domains . The binding pocket is formed by highly conserved residues in the core of the protein, which is consistent with the high degree of sequence conservation observed across species .

Key structural features likely include:

  • An aspartate residue in transmembrane domain 3 (TM3) involved in binding the amine group of the catecholamine side chain

  • Two serine residues in transmembrane domain 5 (TM5) that serve as hydrogen bond donors to bind the hydroxyl groups of the catechol moiety

  • A narrow binding pocket defined by the arrangement of the seven transmembrane helices

Given the high conservation of D2 receptors across species, these binding mechanisms likely apply to the Meleagris gallopavo D2 receptor as well, though species-specific variations in binding affinity and selectivity may exist.

How does the pharmacological profile of the turkey D(2) receptor compare to mammalian D2 receptors?

Researchers investigating these differences should consider:

  • Potential variations in binding pocket residues that could affect ligand selectivity

  • Differences in G protein coupling efficiency that might influence signaling outcomes

  • Species-specific post-translational modifications that could alter receptor function

  • Variations in the third intracellular loop region, which is critical for G protein interaction

Comparative pharmacological profiling using standardized ligand panels would be valuable for establishing species-specific pharmacological fingerprints and identifying compounds with differential activity across species.

What methodologies are most effective for studying receptor-ligand interactions of the turkey D(2) receptor?

Based on general principles for GPCR research, effective methodologies for studying turkey D(2) receptor-ligand interactions would include:

  • Radioligand binding assays: Using radiolabeled D2 receptor ligands to measure binding affinities and kinetics

  • FRET/BRET-based approaches: For real-time monitoring of receptor conformational changes upon ligand binding

  • Surface plasmon resonance: To determine binding kinetics with purified receptor preparations

  • Computational modeling and docking: Leveraging the known sequence to predict ligand binding modes

  • Site-directed mutagenesis: To identify critical residues involved in ligand recognition and binding

The choice of methodology depends on the specific research question, with binding assays providing direct affinity measurements, while functional assays reveal the consequences of receptor activation. Combining multiple approaches offers the most comprehensive characterization of receptor-ligand interactions.

How can research on the turkey D(2) receptor contribute to evolutionary neuropharmacology?

The turkey D(2) receptor provides a valuable model for evolutionary neuropharmacology due to its position in vertebrate phylogeny. Research on this receptor can reveal:

  • Evolutionary conservation of core dopaminergic signaling mechanisms across the vertebrate lineage

  • Avian-specific adaptations in dopamine receptor structure and function

  • Pharmacological diversity that may inform drug development targeting specific species or receptor subtypes

  • Comparative insights into the neural basis of behaviors modulated by dopamine

The cloning and tissue distribution analysis of the turkey D2 receptor enables investigation of dopamine's functional role in avian physiology and behavior, providing a comparative perspective that enhances our understanding of dopaminergic system evolution . This knowledge contributes to fundamental neuroscience while potentially informing translational applications in veterinary medicine and agricultural science.

What are the recommended protocols for storage and handling of recombinant turkey D(2) receptor?

For optimal integrity and functionality of recombinant Meleagris gallopavo D(2) dopamine receptor, the following storage and handling protocols are recommended:

ParameterRecommendation
Storage temperature-20°C/-80°C upon receipt
AliquotingNecessary for multiple use; avoid repeated freeze-thaw cycles
ReconstitutionBriefly centrifuge prior to opening; reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Long-term storageAdd 5-50% glycerol (final concentration) and aliquot
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0
Working aliquotsStore at 4°C for up to one week
Quality control≥85-90% purity as determined by SDS-PAGE

Following these guidelines will help maintain protein stability and functionality for extended periods, allowing for reliable experimental outcomes . It is particularly important to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity.

What techniques are available for validating the functionality of purified recombinant receptor preparations?

While specific validation methods for the turkey D2 receptor are not explicitly detailed in the search results, standard techniques for GPCR validation include:

  • Ligand binding assays: Confirming the ability to bind known D2 receptor agonists and antagonists with expected affinity ranges

  • G protein coupling assays: Verifying functional coupling to Gαi/o proteins, which is characteristic of D2 receptors

  • Second messenger assays: Measuring inhibition of adenylyl cyclase activity and reduction in cAMP levels following receptor activation

  • GTPγS binding assays: Assessing G protein activation in response to agonist binding

  • Conformational analysis: Using techniques like circular dichroism to assess proper protein folding

Validation should include positive controls (known D2 receptor ligands) and negative controls to ensure specificity. For comparative studies, parallel testing with mammalian D2 receptors can provide valuable benchmarking data.

What expression and purification strategies yield the highest quality recombinant turkey D(2) receptor?

Based on the search results, several approaches can be used to optimize expression and purification of high-quality recombinant Meleagris gallopavo D(2) receptor:

  • Expression system selection: While E. coli is commonly used, membrane proteins like GPCRs often benefit from eukaryotic expression systems that provide appropriate post-translational modifications and folding machinery .

  • Fusion tags: His-tags facilitate purification using metal affinity chromatography while minimally impacting receptor function .

  • Purification method: Multi-step purification typically yields the highest purity:

    • Initial capture using affinity chromatography (His-tag)

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Quality assessment: SDS-PAGE analysis should confirm ≥85-90% purity .

  • Detergent selection: Critical for maintaining receptor stability during extraction from membranes and subsequent purification steps.

The optimal strategy depends on the intended application, with structural studies requiring higher purity than functional assays. Careful optimization of each step is essential for producing receptor preparations that maintain native-like properties.

What are the critical factors to consider when designing binding and functional assays using the turkey D(2) receptor?

When designing assays for the turkey D(2) receptor, researchers should consider several critical factors:

  • Receptor preparation: Membrane preparations vs. purified receptor influences assay sensitivity and specificity

  • Buffer composition: pH, ionic strength, and presence of divalent cations (particularly Mg²⁺) affect binding properties

  • Ligand selection: Using known D2 receptor agonists and antagonists, considering potential species differences in pharmacology

  • Temperature and incubation time: Optimization required for equilibrium binding studies

  • Signal detection method: Options include:

    • Radioligand binding for direct measurement of ligand-receptor interactions

    • FRET/BRET-based assays for real-time monitoring of receptor activation

    • GTPγS binding or cAMP assays for functional response measurement

  • Controls: Including positive controls (known D2 ligands) and negative controls (non-specific binding)

  • Data analysis: Appropriate models for binding kinetics and dose-response relationships

Preliminary characterization with well-established ligands provides a foundation for more complex pharmacological investigations. Comparative studies with mammalian D2 receptors may help identify species-specific pharmacological profiles.

What are the advantages and limitations of using different expression systems for the turkey D(2) receptor?

Each expression system offers distinct advantages and limitations for producing recombinant turkey D(2) receptor:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli- Cost-effective
- Rapid production
- High yield
- Simple scale-up
- Limited post-translational modifications
- Improper folding of complex proteins
- Inclusion body formation requiring refolding
1-5 mg/L
Yeast- Some post-translational modifications
- Better folding than bacteria
- Moderate cost
- High cell density cultures
- Hyperglycosylation
- Different lipid environment
- Suboptimal for some mammalian proteins
0.5-2 mg/L
Baculovirus/Insect- Advanced eukaryotic processing
- High expression levels
- Near-native folding
- Suitable for GPCRs
- More expensive
- Longer production time
- Technical complexity
- Different glycosylation patterns
0.5-5 mg/L
Mammalian Cell- Native-like modifications
- Proper folding and trafficking
- Appropriate cellular machinery
- Authentic functional properties
- Highest cost
- Lowest yields
- Most time-consuming
- Technical expertise required
0.1-1 mg/L

How can the turkey D(2) receptor be used as a tool in comparative neuropharmacology?

The turkey D(2) receptor offers several valuable applications in comparative neuropharmacology:

  • Evolutionary insights: Comparing pharmacological profiles across species helps trace the evolution of neurotransmitter systems and receptor properties throughout vertebrate lineages.

  • Drug selectivity studies: Identifying compounds with species-selective activity can inform the development of targeted therapeutics.

  • Structure-function relationships: The high conservation of certain domains across species highlights functionally critical regions, while variations may reveal species-specific adaptations.

  • Comparative binding site analysis: Differences in binding pocket architecture between avian and mammalian receptors can reveal fundamental principles of ligand recognition.

  • Modeling studies: The turkey receptor provides an additional template for homology modeling of D2 receptors from species lacking experimental structures.

These applications contribute to our fundamental understanding of receptor biology while potentially informing drug discovery efforts targeting specific species or receptor subtypes .

What are the experimental challenges specific to working with avian dopamine receptors?

While not explicitly detailed in the search results, researchers working with avian dopamine receptors likely face several unique challenges:

  • Limited reagent availability: Fewer commercially available antibodies and detection tools specifically validated for avian receptors.

  • Pharmacological differences: Potential species-specific differences in ligand affinity and selectivity requiring careful validation of tools developed for mammalian systems.

  • Expression optimization: Determining optimal conditions for functional expression that preserve avian-specific properties while achieving sufficient yields.

  • Assay adaptation: Standard assays developed for mammalian receptors may require optimization for avian receptors due to differences in optimal buffer conditions, temperature sensitivity, or coupling efficiency.

  • Interpretation complexities: Placing findings in appropriate evolutionary and functional context requires integration with broader comparative literature.

Addressing these challenges requires careful experimental design and validation, potentially developing avian-specific tools and protocols to ensure reliable results.

How does the turkey D(2) receptor contribute to our understanding of dopaminergic system evolution?

The turkey D(2) receptor provides valuable insights into dopaminergic system evolution through several means:

  • Sequence conservation analysis: The high degree of conservation observed between turkey and mammalian D2 receptors highlights functionally critical domains that have been maintained throughout vertebrate evolution .

  • Structural comparison: Variations in receptor structure between avian and mammalian species can reveal lineage-specific adaptations in dopaminergic signaling.

  • Distribution patterns: The widespread expression throughout the turkey brain parallels the distribution in mammals, suggesting conserved functional roles across vertebrate classes .

  • Alternative splicing: The presence of splice variants similar to those in mammals indicates conservation of regulatory mechanisms controlling receptor expression and function .

  • Pharmacological profiling: Comparative pharmacology can reveal evolutionary divergence or conservation in ligand recognition and signaling preferences.

These contributions enhance our understanding of how dopaminergic systems have evolved while maintaining core functionality, providing context for interpreting species-specific adaptations in neurochemical signaling .

What experimental designs are most effective for studying the physiological roles of the turkey D(2) receptor in vivo?

While specific experimental designs for in vivo studies of the turkey D(2) receptor are not detailed in the search results, effective approaches would likely include:

  • Pharmacological manipulation: Administration of selective D2 agonists and antagonists followed by behavioral or physiological measurements.

  • In vivo microdialysis: Measuring changes in dopamine release and turnover in response to receptor modulation.

  • Electrophysiological recordings: Assessing neuronal activity patterns in dopaminergic circuits following receptor activation or inhibition.

  • Developmental studies: Examining receptor expression and function during different developmental stages.

  • Environmental manipulations: Studying how environmental factors (photoperiod, stress, social interactions) affect receptor expression and function.

Such studies would build upon the foundational work describing receptor distribution and molecular characteristics, connecting molecular features to physiological functions in the intact organism .

How can understanding the turkey D(2) receptor inform research in avian models of neurological disorders?

The characterization of the turkey D(2) receptor enables comparative research on neurological disorders with dopaminergic involvement. Specific applications include:

  • Developing avian models: Creating and validating bird models of conditions like Parkinson's disease, schizophrenia, or addiction that involve dopaminergic dysfunction.

  • Comparative pharmacology: Testing how drugs developed for human disorders interact with avian receptors, revealing potential species differences in therapeutic response.

  • Evolutionary medicine: Understanding how dopaminergic systems have adapted differently across species can provide insights into vulnerability or resistance to certain pathologies.

  • Agricultural applications: Addressing behavioral or physiological issues in poultry that may involve dopaminergic systems.

  • One Health approaches: Integrating findings across species to develop broader understanding of dopaminergic disorders relevant to both human and veterinary medicine.

The extensive conservation of the D2 receptor across species indicates its fundamental importance in nervous system function and suggests that insights from avian models may have translational relevance to mammalian systems, including humans .

What are the most promising future research directions for the turkey D(2) receptor?

Future research on the Meleagris gallopavo D(2) dopamine receptor would benefit from several promising directions:

  • Comprehensive pharmacological profiling: Systematic comparison of ligand binding and functional properties between avian and mammalian D2 receptors to identify species-specific characteristics.

  • Structural biology: Determination of the three-dimensional structure of the turkey D2 receptor through X-ray crystallography or cryo-electron microscopy to enable detailed structural comparisons.

  • Signaling pathway characterization: Elucidation of the specific G protein coupling preferences and downstream signaling cascades activated by the turkey D2 receptor.

  • Physiological role determination: Investigation of the receptor's role in avian-specific behaviors and physiological processes through in vivo studies.

  • Development of selective tools: Creation of turkey-specific antibodies, ligands, and genetic tools to facilitate more detailed studies.

These directions would build upon the foundational work described in the search results, expanding our understanding of this receptor's molecular characteristics, evolutionary significance, and physiological roles .

How can comparative studies of the turkey D(2) receptor advance drug discovery efforts?

Comparative studies of the turkey D(2) receptor can contribute to drug discovery in several ways:

  • Identifying conserved binding pocket features: Revealing essential structural elements that should be targeted for broad-spectrum activity across species.

  • Highlighting species-specific differences: Identifying regions that could be exploited for developing species-selective compounds.

  • Providing additional templates: Offering complementary structural models for virtual screening and rational drug design.

  • Understanding selectivity determinants: Clarifying the molecular basis of ligand selectivity through comparative structure-activity relationships.

  • Predicting side effects: Helping anticipate potential cross-species effects of drugs designed for human use on wildlife or domesticated animals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.