Recombinant Meleagris gallopavo Leptin receptor gene-related protein (LEPROT)

Shipped with Ice Packs
In Stock

Description

Genomic Structure and Protein Properties

LEPROT belongs to a family of genes that includes LEPROT-like 1 (LEPROTL1) in higher organisms and vacuolar protein sorting 55 (VPS55) in Saccharomyces cerevisiae . The LEPROT family encodes small proteins of approximately 131-140 amino acids with four potential transmembrane domains . In turkeys specifically, research has identified and characterized the LEPR gene-related protein (LEPR-GRP) mRNA transcript, which encodes a 14-kDa protein consisting of 131 amino acids that is distinct from the leptin receptor itself . This protein shares structural similarities with LEPROT proteins identified in other species, suggesting evolutionary conservation of this important regulatory molecule.

The turkey LEPR gene (long form) encodes a protein of 1147 amino acids with characteristic features including a signal peptide, a single transmembrane domain, and specific conserved motifs defining putative leptin-binding and signal transduction regions . While the turkey LEPR shares greater than 90% sequence identity at both nucleotide and amino acid levels with chicken LEPR, the LEPR-GRP (LEPROT) represents a distinct molecular entity that likely plays significant roles in modulating leptin and growth hormone signaling pathways .

Evolutionary Conservation and Comparative Analysis

LEPROT shows considerable evolutionary conservation across species, highlighting its fundamental importance in cellular processes. The LEPROT family members function as tetraspanning membrane proteins that appear to be involved in the regulation of receptor expression and trafficking . Comparative analyses suggest that these proteins are part of functional complexes that include at least one small membrane protein with four putative transmembrane domains, as evidenced by the interaction between Vps55p and Vps68p in yeast systems .

Regulation of Growth Hormone Signaling

One of the most significant roles of LEPROT appears to be in the regulation of growth hormone (GH) signaling. Research in mammalian models has demonstrated that LEPROT, along with LEPROTL1, cooperatively decreases hepatic growth hormone sensitivity . Transgenic mice expressing either human LEPROT or human LEPROTL1 displayed notable growth retardation, reduced plasma IGF1 levels, and impaired hepatic sensitivity to GH, as measured by STAT5 phosphorylation and Socs2 mRNA expression . These phenotypes were more pronounced in mice expressing both proteins, suggesting synergistic effects .

Importantly, gene silencing experiments of endogenous Leprot or Leprotl1 in hepatocytes resulted in increased GH signaling and enhanced cell-surface GH receptor expression, confirming the inhibitory role of these proteins in GH signaling . While these studies were conducted in mammalian models, the high degree of conservation suggests similar functions may exist in avian species, including turkeys.

Protein Trafficking and Receptor Expression

LEPROT plays a crucial role in protein trafficking and receptor expression at the cell surface. Studies have demonstrated that LEPROT negatively regulates leptin receptor cell-surface expression . The importance of tetraspanning membrane proteins like LEPROT in protein trafficking has been highlighted by studies in yeast, where disruption of the VPS55 gene resulted in normal endocytosis but delayed vacuolar degradation of proteins .

Human LEPROT expression in yeast localizes similarly to Vps55p, primarily in late endosomes, and can correct vacuolar targeting defects in vps55Δ cells . This suggests an evolutionarily conserved role for LEPROT in the downregulation of membrane protein levels and their targeting from late endosomes to lysosomes . In the context of turkey physiology, such mechanisms could significantly impact growth and metabolic regulation through modulation of receptor availability at the cell surface.

Metabolic Regulation and Nutritional Signaling

LEPROT and LEPROTL1 expression are regulated by physiological and pathological changes in glucose homeostasis, suggesting they may constitute a molecular link between nutritional signals and growth hormone actions affecting body growth and metabolism . This relationship is particularly significant given that growth hormone functions as a major metabolic regulator by stimulating lipolysis, preventing protein catabolism, and decreasing insulin-dependent glucose disposal .

During periods of reduced nutrient availability, the liver becomes resistant to GH actions, though the mechanisms controlling this hepatic GH resistance have not been fully elucidated . The regulation of LEPROT and related proteins may represent one mechanism by which nutritional status influences growth hormone sensitivity and subsequent metabolic outcomes.

Tissue Distribution and Developmental Regulation

The expression of LEPR in turkeys has been quantified relative to β-actin in various tissues of 3-week-old turkey poults . The highest expression levels were observed in brain, spleen, and lung tissue, with lower levels detected in kidney, pancreas, duodenum, liver, fat, and breast muscle . This diverse tissue distribution suggests multiple physiological roles for the leptin signaling system in turkey development and metabolism.

In developing turkey embryos, LEPR expression was highest in brain tissue throughout incubation (days 14-28) . Expression in embryonic liver tissue peaked at day 16 and then declined toward hatching (day 28), while yolk sac expression declined from day 14 to day 20 before increasing toward hatching . These dynamic expression patterns during embryonic development suggest important roles in tissue differentiation and maturation.

While these observations relate specifically to the LEPR rather than LEPROT itself, they provide context for understanding the leptin signaling system in turkeys. Based on mammalian studies showing coordinated regulation and function of LEPROT and leptin receptors, similar developmental and tissue-specific expression patterns might be expected for LEPROT in turkeys.

Expression Systems and Assay Development

The production of recombinant LEPROT proteins has been instrumental in studying their biological functions. Expression systems typically involve transfection of the full-length cDNA into suitable cell lines, such as human embryonic kidney (HEK)-293 cells, which can be used for functional assays . For leptin receptor studies, stable transfection with LEPR cDNA together with a STAT3-responsive reporter gene has enabled the development of bioassays for monitoring leptin activity .

Similar approaches could be applied for recombinant turkey LEPROT production, potentially using avian cell lines for more physiologically relevant expression. The creation of stable cell lines expressing turkey LEPROT would provide valuable tools for investigating its functional properties and interactions with other signaling components.

Functional Analysis of Recombinant LEPROT

Recombinant LEPROT proteins can be used in various functional assays to assess their impact on receptor trafficking, signaling pathway activation, and metabolic regulation. In mammalian studies, transgenic expression of human LEPROT resulted in notable phenotypic effects including growth retardation and reduced IGF1 levels . These observations highlight the potential utility of recombinant LEPROT for studying growth and metabolic regulation in turkeys.

Growth Regulation and Production Efficiency

Given the demonstrated role of LEPROT in growth hormone signaling and its impact on body growth in mammalian models, similar functions in turkeys could have significant implications for poultry production. Growth retardation observed in LEPROT-overexpressing mice suggests that modulation of LEPROT expression or activity could potentially influence growth rates and body composition in turkeys .

Metabolic Regulation and Stress Response

LEPROT's role in modulating growth hormone sensitivity in response to nutritional status suggests potential applications in managing metabolic responses to environmental and nutritional stressors in poultry production. The liver's resistance to GH actions during periods of reduced nutrient availability represents an important adaptive mechanism , and understanding the molecular basis of this response could inform feeding strategies and stress management in commercial turkey production.

Research Gaps and Future Opportunities

Despite the valuable insights gained from mammalian studies and preliminary characterization in turkeys, significant knowledge gaps remain regarding the specific functions and regulatory mechanisms of LEPROT in Meleagris gallopavo. Future research directions should include:

  1. Comprehensive characterization of turkey LEPROT structure and post-translational modifications

  2. Detailed mapping of LEPROT expression patterns across tissues and developmental stages

  3. Investigation of LEPROT's interactions with signaling pathways beyond growth hormone

  4. Development of turkey-specific antibodies and assays for LEPROT detection and quantification

  5. Exploration of genetic variation in LEPROT and its association with production traits

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LEPROT; LEPR-GRP; Leptin receptor gene-related protein; Endospanin-1; OB-R gene-related protein; OB-RGRP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Meleagris gallopavo (Wild turkey)
Target Names
LEPROT
Target Protein Sequence
MAGIKALVGLSFSGAIGLTFLMLGCALEYYGVYWPMFVLIFYFICPIPHFIARRVSDDSD AASSACRELAYFFTTGIVVSAFGFPIILARVEAIKWGACGLVLAGNAVIFLTILGFFLVF GRGDDFSWEQW
Uniprot No.

Target Background

Function
Involved in protein trafficking. May be implicated in the down-regulation of membrane protein levels.
Database Links
Protein Families
OB-RGRP/VPS55 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Endosome membrane.
Tissue Specificity
Widely expressed, including in liver, duodenum, kidney, pancreas, lung, spleen and brain.

Q&A

What is Leptin receptor gene-related protein (LEPROT) and what is its relationship to the leptin signaling pathway?

LEPROT, also known as OB-R gene-related protein (OB-RGRP), is a small tetraspanning membrane protein consisting of 131 amino acids in Meleagris gallopavo. Despite its name suggesting association with leptin receptor function, LEPROT actually belongs to a protein family that includes LEPROTL1 and yeast VPS55, which are primarily involved in protein trafficking mechanisms. LEPROT has been demonstrated to negatively regulate leptin receptor cell-surface expression and consequently reduce leptin signaling. The protein contains four potential transmembrane domains and plays a crucial role in the downregulation of membrane protein levels, particularly in targeting proteins from late endosomes to lysosomes .

What are the structural characteristics of Meleagris gallopavo LEPROT?

Meleagris gallopavo LEPROT (UniProt accession: Q5PSV5) is a 131-amino acid protein with four predicted transmembrane domains. Its amino acid sequence is: MAGIKALVGLSFSGAIGTFLMLGCALEYYGVYWPMVLIFYFICPIPHFIARRVSDDSDAASSACRELAYFFTTGIVVSAFGFPIILARVEAIKWGACGLVLAGNAVIFLTILGFFLVFGRGDDFSWEQW. The protein's small size and tetraspanning structure are conserved features across species, indicating its fundamental importance in cellular functions. The transmembrane topology is critical for its localization to late endosomes and functional role in protein trafficking .

What are the optimal conditions for handling recombinant Meleagris gallopavo LEPROT?

For optimal handling of recombinant Meleagris gallopavo LEPROT, store the protein at -20°C for regular usage, or at -80°C for extended storage. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for stability. To preserve protein integrity, avoid repeated freeze-thaw cycles. If working with the protein over a short period, prepare working aliquots that can be stored at 4°C for up to one week. When designing experiments, account for the protein's tag type (which may vary depending on the production process) and consider its potential impact on protein function or antibody recognition .

What experimental approaches are most effective for studying LEPROT's impact on growth hormone signaling?

To effectively study LEPROT's impact on growth hormone signaling, multiple complementary approaches are recommended:

  • In vivo transgenic models: Generate transgenic mice overexpressing LEPROT to assess whole-organism effects on growth, as demonstrated by studies showing growth retardation and reduced plasma IGF1 levels in LEPROT transgenic mice.

  • STAT5 phosphorylation assays: Measure tyrosine phosphorylation of STAT5 following GH stimulation in both control and LEPROT-overexpressing conditions to quantify signaling efficiency.

  • Receptor binding studies: Perform [125I]GH-binding assays on isolated primary hepatocytes to determine cell-surface GH receptor abundance in the presence of variable LEPROT expression.

  • Gene silencing experiments: Use siRNA targeting endogenous Leprot in hepatocyte cell lines (such as H4IIE) to assess whether GH signaling increases when LEPROT is downregulated.

  • Real-time qPCR: Monitor expression of downstream GH-responsive genes such as Socs2 to evaluate signaling pathway activity.

These techniques collectively provide a comprehensive assessment of how LEPROT modulates GH signaling pathways at multiple levels .

How does LEPROT expression affect growth hormone receptor (GHR) at the cellular level?

LEPROT expression significantly reduces cell-surface growth hormone receptor (GHR) abundance without altering GHR gene expression. In controlled experimental systems, LEPROT overexpression reduces cell-surface [125I]GH binding by approximately 75%, with a dose-dependent effect observed with increasing amounts of LEPROT expression vector. Scatchard analysis confirms a substantial decrease in Bmax (from 0.4 nM in control cells to 0.02 nM in LEPROT-expressing cells), demonstrating reduced maximum GH-binding potential. This effect appears to be specific to GHR, as LEPROT does not affect cell-surface EGF-binding capacity in EGFR-transfected cells under similar experimental conditions. Importantly, LEPROT's effect on GHR is not accompanied by increased soluble growth hormone binding protein (GHBP) in the medium, indicating that LEPROT does not enhance proteolytic cleavage of the receptor at the cell surface .

What is the functional relationship between LEPROT and LEPROTL1 in regulating growth hormone signaling?

LEPROT and LEPROTL1 demonstrate a cooperative relationship in regulating growth hormone signaling:

  • Both proteins independently decrease hepatic GH sensitivity when overexpressed, as measured by reduced STAT5 phosphorylation and diminished Socs2 mRNA expression in response to GH stimulation.

  • Transgenic mice expressing both proteins exhibit more pronounced phenotypes than single-transgenic animals, indicating additive or synergistic effects.

  • In cellular models, co-transfection of both LEPROT and LEPROTL1 produces a greater reduction in cell-surface GH binding compared to single transfections.

  • While functionally similar, LEPROT and LEPROTL1 show some mechanistic differences: LEPROTL1 decreases soluble GHBP abundance by approximately 50%, whereas LEPROT has no significant effect on GHBP levels.

  • Gene silencing experiments demonstrate that knockdown of either endogenous Leprot or Leprotl1 in hepatocytes increases GH signaling and enhances cell-surface GH receptor expression.

This relationship suggests that both proteins work through related but potentially distinct mechanisms to modulate GH sensitivity, providing redundancy in this regulatory system .

How can researchers differentiate between the effects of LEPROT on receptor trafficking versus its effects on signaling duration?

To differentiate between LEPROT's effects on receptor trafficking versus signaling duration, researchers should implement a multi-faceted experimental approach:

  • Pulse-chase studies: Label cell-surface GHR with biotin or a non-permeable labeling reagent, then track its internalization and degradation rates in the presence and absence of LEPROT overexpression. This approach can distinguish between altered trafficking kinetics and changes in total receptor abundance.

  • Subcellular fractionation: Isolate membrane, endosomal, and lysosomal fractions to quantify GHR distribution across cellular compartments, determining whether LEPROT promotes receptor redistribution rather than degradation.

  • Live-cell imaging: Use fluorescently tagged GHR to visualize receptor movement in real-time, comparing trafficking patterns between control and LEPROT-expressing cells.

  • Signaling kinetics analysis: Measure STAT5 phosphorylation at multiple time points after GH stimulation to determine whether LEPROT affects signal initiation, peak intensity, or termination phase.

  • Inhibitor studies: Apply specific inhibitors of lysosomal function (e.g., chloroquine) or endosomal trafficking (e.g., dominant-negative Rab proteins) to determine whether LEPROT's effects are abolished when certain trafficking pathways are blocked.

These approaches can help resolve whether LEPROT primarily affects receptor delivery to the cell surface, accelerates endocytosis, inhibits recycling, enhances lysosomal degradation, or directly interferes with signaling complex formation .

What physiological conditions regulate LEPROT and LEPROTL1 expression in relation to metabolic homeostasis?

LEPROT and LEPROTL1 expression in the liver is regulated by physiological and pathological changes in glucose homeostasis, suggesting these proteins serve as molecular links between nutritional signals and growth hormone actions. Research has demonstrated that both LEPROT and LEPROTL1 show increased expression under conditions associated with GH resistance, such as Type 1 Diabetes Mellitus (T1DM). This regulation appears to be part of the adaptive response to variations in food availability.

During periods of reduced nutrient availability, when the liver naturally becomes resistant to GH actions, LEPROT and LEPROTL1 expression may be upregulated to mediate this resistance. This mechanism represents a sophisticated control system that integrates nutritional status with growth hormone sensitivity to appropriately adjust metabolic functions including lipolysis, protein catabolism prevention, and insulin-dependent glucose disposal.

For researchers investigating this relationship, experimental models should include:

  • Fasting-refeeding studies to examine acute nutritional regulation

  • Diabetes models (both Type 1 and insulin-resistant states)

  • Caloric restriction paradigms of varying duration

  • Examination of hormonal regulators (insulin, glucagon, cortisol) that might mediate these effects

Tissue-specific knockout models would be particularly valuable for distinguishing direct nutritional sensing from secondary hormonal effects .

What are the critical controls needed when performing GH binding assays in LEPROT studies?

When performing growth hormone binding assays in LEPROT studies, researchers must implement several critical controls to ensure reliable and interpretable results:

  • Lactogenic site saturation: Include high concentrations of human prolactin to saturate lactogenic binding sites when measuring specific GH binding, as demonstrated in primary hepatocyte experiments with [125I]GH binding assays.

  • mRNA quantification: Always perform parallel measurements of GHR mRNA levels to confirm that any observed changes in binding are not due to transcriptional regulation.

  • Temperature control: Conduct cell-surface-specific binding assays at 4°C to prevent receptor internalization during the experiment, which would confound interpretation of surface receptor abundance.

  • Dose-response analysis: Use increasing amounts of LEPROT or LEPROTL1 expression vectors to establish dose-dependency of effects.

  • Receptor specificity control: Include parallel binding studies with an unrelated receptor (such as EGFR with [125I]EGF) to confirm specificity of LEPROT effects for GHR rather than general membrane protein expression.

  • Scatchard analysis: Perform full Scatchard analysis to distinguish between changes in receptor number (Bmax) and binding affinity (Kd).

  • Soluble receptor measurement: Measure soluble GHBP in media to account for potential alterations in receptor shedding that might affect cell-surface binding measurements.

These controls collectively ensure that observed changes in GH binding truly reflect LEPROT's specific effect on cell-surface GHR abundance rather than experimental artifacts or indirect effects .

How can researchers effectively measure the impact of LEPROT on intracellular GHR trafficking?

To effectively measure LEPROT's impact on intracellular GHR trafficking, researchers should employ multiple complementary techniques:

  • Confocal microscopy with co-localization studies: Use fluorescently-labeled antibodies against GHR and markers for different cellular compartments (early endosomes, late endosomes, lysosomes, recycling endosomes) to visualize and quantify receptor distribution patterns.

  • Endosomal isolation and Western blotting: Fractionate cells to isolate different endosomal populations and quantify GHR content by Western blotting in each fraction, comparing LEPROT-expressing versus control cells.

  • Receptor internalization assays: Label cell-surface proteins with cleavable biotin, allow internalization to proceed for various time intervals, remove remaining surface biotin, and then quantify internalized biotinylated GHR.

  • Receptor recycling assays: After allowing labeled GHR to internalize, measure the rate of its return to the cell surface in the presence and absence of LEPROT.

  • Lysosomal inhibition studies: Use agents like bafilomycin A1 or chloroquine to inhibit lysosomal degradation and assess GHR accumulation in LEPROT-expressing versus control cells.

  • Pulse-chase protein synthesis and degradation: Label newly synthesized proteins with radioactive amino acids and track GHR synthesis, maturation, and degradation rates over time.

  • Total internal reflection fluorescence (TIRF) microscopy: Monitor GHR insertion events at the plasma membrane to determine if LEPROT affects forward trafficking from the Golgi to the cell surface.

These approaches collectively provide a comprehensive assessment of how LEPROT influences each step of GHR's intracellular itinerary .

How should researchers interpret the cooperative effects of LEPROT and LEPROTL1 on growth hormone signaling?

When analyzing the cooperative effects of LEPROT and LEPROTL1 on growth hormone signaling, researchers should consider several interpretative frameworks:

  • Quantitative versus qualitative effects: Determine whether the enhanced inhibition observed with both proteins represents a simple additive effect (quantitative) or reflects engagement of distinct mechanistic pathways (qualitative). This distinction can be assessed by comparing the observed cooperative effect against mathematical models of predicted additive behavior.

  • Threshold versus gradual response: Analyze whether the data suggest a threshold effect (where a certain combined level of LEPROT/LEPROTL1 triggers a dramatic response) or a more gradual dose-response relationship. Plot relevant parameters (e.g., STAT5 phosphorylation, IGF1 levels) against combined LEPROT/LEPROTL1 expression to visualize the relationship pattern.

  • Temporal dynamics: Consider whether the proteins affect different temporal phases of GH signaling. For example, one protein might primarily affect initial receptor availability while the other influences signal duration or termination.

  • Feedback mechanisms: Assess whether the enhanced effect involves engagement of additional feedback mechanisms not activated by either protein alone. This can be examined by measuring expression of negative regulators like SOCS proteins.

  • Tissue-specific variations: Compare the magnitude of cooperative effects across different tissues or cell types to identify contexts where cooperation is enhanced or diminished.

  • Developmental timing: Analyze whether cooperative effects are more pronounced during specific developmental stages or metabolic states.

Experimental data from transgenic mice expressing both proteins, which show accentuated phenotypes compared to single-transgenic animals, support a genuine cooperative relationship rather than redundancy .

What statistical approaches are most appropriate for analyzing changes in GH receptor abundance and signaling in LEPROT studies?

When analyzing changes in GH receptor abundance and signaling in LEPROT studies, researchers should employ the following statistical approaches:

  • Repeated measures ANOVA: For time-course experiments measuring GH-induced STAT5 phosphorylation, use repeated measures ANOVA to account for within-subject correlations over time, followed by appropriate post-hoc tests to identify specific time points with significant differences.

  • Linear regression analysis for dose-response relationships: When examining the effect of varying LEPROT expression levels on GHR parameters, use regression analysis to characterize the relationship (linear, logarithmic, or sigmoidal) and determine EC50 values.

  • Paired experimental designs: When comparing GH binding before and after interventions in the same cell population, use paired t-tests to increase statistical power by controlling for baseline variability.

  • Multiple comparison correction: When analyzing changes across multiple parameters (e.g., different signaling proteins in the GH pathway), employ Bonferroni or false discovery rate corrections to maintain appropriate experiment-wide error rates.

  • Two-way ANOVA for interaction effects: When studying how LEPROT and LEPROTL1 cooperatively affect GH signaling, use two-way ANOVA to formally test for interaction effects beyond additive contributions.

  • Normalization strategies: For Western blot analyses of phosphorylated signaling proteins, normalize phospho-protein signals to total protein levels (e.g., p-STAT5/STAT5 ratio) rather than housekeeping proteins to accurately reflect activation status.

  • Non-parametric alternatives: If data do not meet assumptions of normality, use appropriate non-parametric tests (Mann-Whitney U test, Wilcoxon signed-rank test) for between-group comparisons.

These statistical approaches ensure robust analysis of LEPROT's effects on GH receptor dynamics while appropriately controlling for experimental variables and avoiding false positives .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.