Recombinant Meleagris gallopavo Type-1 angiotensin II receptor (AGTR1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant AGTR1 is synthesized using codon-optimized DNA sequences inserted into expression vectors. Key steps include:

  • Host Systems: Flexible expression in bacterial (E. coli), insect (baculovirus), or mammalian cells .

  • Purification: Affinity chromatography (e.g., His-tag purification), yielding >85% purity .

  • Yield: Varies by system; mammalian cells typically produce higher-fold soluble protein .

Functional Insights from Avian Studies

Studies on turkey adrenal cells reveal AGTR1’s role in calcium signaling and steroidogenesis:

  • Calcium Mobilization: AGTR1 activation induces rapid intracellular Ca²⁺ influx, triggering aldosterone production .

  • Pharmacological Profile:

    • Poor discrimination between mammalian antagonists (losartan and PD123177) .

    • Internalization dynamics: 70% surface-bound vs. 30% internalized receptors at equilibrium .

Antibody Development

  • AGTR1-specific antibodies (e.g., ab124734) are validated for Western blot, ELISA, and immunohistochemistry, cross-reacting with human, mouse, and rat homologs .

  • Epitope mapping confirms reactivity with extracellular domains .

Disease Modeling

  • Overexpression in neuroendocrine tumors (NETs) suggests therapeutic targeting potential .

  • Comparative studies highlight evolutionary divergence from mammalian AGTR1 in ligand binding and signaling .

Comparative Analysis with Human AGTR1

FeatureM. gallopavo AGTR1Human AGTR1
Chromosomal LocationNot fully mappedChromosome 3 (3q24)
Receptor Internalization70% surface-bound Rapid internalization post-activation
Antagonist SensitivityLow discrimination (losartan/PD123177) High specificity for losartan

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag type, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Meleagris gallopavo (Wild turkey)
Target Names
Target Protein Sequence
MVPNYSTEETVKRIHVDCPVSGRHSYIYIMVPTVYSIIFIIGIFGNSLVVIVIYCYMKLK TVASIFLLNLALADLCFLITLPLWAAYTAMEYQWPFGNCLCKLASAGISFNLYASVFLLT CLSIDRYLAIVHPVKSRIRRTMFVARVTCIVIWLLAGVASLPVIIHRNIFFAENLNMTVC GFRYDNNNTTLRVGLGLSKNLLGFLIPFLIILTSYTLIWKTLKKAYQIQRNKTRNDDIFK MIVAIVFFFFFSWIPHQVFTFLDVLIQLHVITDCKITDIVDTAMPFTICIAYFNNCLNPF FYVFFGKNFKKYFLQLIKYIPPNVSTHPSLTTKMSSLSYRPPENIRLPTKKTAGSFDTE
Uniprot No.

Target Background

Function
The angiotensin II receptor type 1 (AGTR1) is a receptor for angiotensin II. It mediates angiotensin II's action by associating with G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Adrenal medulla.

Q&A

What is the molecular structure of the Meleagris gallopavo AGTR1 and how does it compare to human AGTR1?

The Meleagris gallopavo (domestic turkey) AGTR1 belongs to the G protein-coupled receptor (GPCR) family with seven transmembrane domains, similar to the human AGTR1. The turkey AGTR1 is pharmacologically distinct from mammalian adrenocortical type-1 receptors despite structural similarities. The human AGTR1 protein has 359 amino acids with a molecular mass of 41.1 kDa in its predominant short isoform, while a longer isoform of 391 amino acids exists with an additional 3.8 kDa . Although complete sequence data for turkey AGTR1 is limited in these search results, research indicates significant pharmacological differences suggesting structural variations in ligand-binding domains.

When designing experiments with recombinant turkey AGTR1, researchers should consider these species-specific differences, particularly in the extracellular domains responsible for ligand recognition.

What expression patterns and tissue distribution are observed for AGTR1 in Meleagris gallopavo?

In domestic turkey, AGTR1 is prominently expressed in adrenal steroidogenic cells, where it mediates physiological responses to angiotensin II . This parallels some aspects of human AGTR1 expression, which is found predominantly in vascular smooth muscle cells, the heart, adrenal gland, and kidney .

For researchers investigating tissue-specific functions:

  • Turkey adrenal tissue provides an excellent model for studying steroidogenic regulation via AGTR1

  • When designing tissue expression studies, consider harvesting adrenal glands at consistent times of day to control for diurnal variations in receptor expression

  • Immunohistochemical detection may require specific antibodies raised against turkey AGTR1 epitopes, as mammalian-targeted antibodies may show reduced cross-reactivity

What are the binding characteristics of angiotensin II to turkey AGTR1 and how do they differ from mammalian systems?

Turkey AGTR1 demonstrates unique binding properties compared to mammalian systems. Equilibrium-binding analysis reveals a single class of binding sites at a concentration of approximately 63,500 sites per cell with an apparent dissociation constant (Kd) of 1.21 nM. Interestingly, the Kd derived from kinetic analyses is lower at 0.27 nM, suggesting complex binding dynamics .

ParameterTurkey AGTR1 ValueNotes
Binding sites per cell63,500Determined by equilibrium binding analysis
Kd (equilibrium)1.21 nMApparent dissociation constant
Kd (kinetic)0.27 nMDerived from association/dissociation kinetics
Internalization~30% at equilibriumPercentage of hormone-receptor complexes internalized

This discrepancy between equilibrium and kinetic Kd values represents an important research question and may reflect complex receptor-ligand interactions or conformational changes. When designing binding studies with recombinant turkey AGTR1, consider performing both equilibrium and kinetic analyses to fully characterize the binding properties.

How does the intracellular signaling of turkey AGTR1 compare to mammalian AGTR1?

Turkey AGTR1 activation by angiotensin II induces an immediate and sustained increase in intracellular Ca²⁺, indicating coupling to calcium signaling pathways. Notably, this response is specific to angiotensin II, as ACTH does not elicit the same effect in turkey adrenal cells .

Dithiothreitol inhibition studies show that the inhibition of maximal AII-induced aldosterone production correlates closely with binding inhibition, suggesting these receptors operate through a non-"spare" receptor mode . This means virtually all receptors need to be occupied to achieve maximal physiological response, an important consideration when designing dose-response experiments.

For researchers studying recombinant turkey AGTR1 signaling:

  • Include calcium flux assays in your functional validation protocols

  • Consider the non-"spare" receptor mode when designing dose-response studies

  • Compare response kinetics with mammalian systems to identify species-specific signaling patterns

What is the receptor internalization pattern for turkey AGTR1?

At equilibrium, approximately 30% of hormone-receptor complexes in turkey adrenal cells are internalized, while 70% remain on the cell surface . This distribution contrasts sharply with patterns reported for mammalian (rat) adrenocortical cells, representing a significant species difference in receptor trafficking and regulation.

For researchers working with recombinant turkey AGTR1:

  • Include internalization studies in your experimental design to confirm proper receptor trafficking

  • Consider the impact of different membrane compositions when expressing recombinant receptors in heterologous systems

  • Time course studies may reveal important differences in internalization kinetics compared to mammalian systems

How does turkey AGTR1 respond to mammalian antagonists?

A critical finding for researchers is that turkey adrenal AGTR1 responds differently to mammalian antagonists compared to mammalian receptors. Specifically, turkey AGTR1 poorly discriminates between the nonpeptide antagonists losartan (DuP 753, type-1 specific) and PD123177 (type-2 specific) .

This pharmacological profile distinguishes turkey AGTR1 from mammalian adrenocortical type-1 receptors and has important implications for experimental design:

  • Standard mammalian receptor subtype-specific antagonists may not reliably differentiate receptor subtypes in avian systems

  • Novel antagonists may need to be developed for selective targeting of avian AGTR1

  • When using recombinant turkey AGTR1 for antagonist screening, compare results with mammalian AGTR1 to identify compounds with species-selectivity

What methodological approaches can differentiate turkey AGTR1 subtypes given their distinct pharmacology?

Given the poor discrimination between type-1 and type-2 specific antagonists, researchers studying turkey AGTR1 subtypes should consider:

  • Combining multiple pharmacological tools rather than relying on single antagonists

  • Developing avian-specific antagonists based on structural differences

  • Using molecular approaches such as receptor subtype-specific siRNA

  • Employing recombinant expression of individual subtypes to characterize their properties in isolation

For functional validation of recombinant turkey AGTR1:

  • Test responses to both losartan and PD123177 across a wide concentration range

  • Compare binding affinities with both peptide and non-peptide ligands

  • Consider developing turkey-specific antibodies for immunological differentiation of subtypes

What expression systems are optimal for producing functional recombinant turkey AGTR1?

Based on approaches used for mammalian AGTR1 and other GPCRs, the following expression systems should be considered:

  • Mammalian cell lines: HEK293 or CHO cells provide appropriate post-translational modifications and membrane insertion for GPCRs.

  • Baculovirus-insect cell systems: These can produce higher yields while maintaining most post-translational modifications required for GPCR functionality.

  • Cell-free systems: Specialized cell-free systems with added microsomes or nanodiscs can support GPCR expression for binding studies.

For optimal functionality:

  • Include N-terminal signal sequences to ensure proper membrane targeting

  • Consider adding epitope tags for purification and detection that don't interfere with ligand binding

  • Validate receptor functionality through binding assays and calcium mobilization studies

  • Express in multiple systems to compare functional properties

What quality control methods can validate recombinant turkey AGTR1 functionality?

To ensure your recombinant turkey AGTR1 preparation is functional:

  • Binding assays: Perform saturation binding with radiolabeled angiotensin II to confirm Kd values similar to native receptors (approximately 1.21 nM for equilibrium binding)

  • Calcium mobilization: Confirm immediate and sustained increases in intracellular Ca²⁺ in response to angiotensin II but not ACTH

  • Internalization studies: Verify that approximately 30% of hormone-receptor complexes are internalized at equilibrium

  • Antagonist discrimination: Test the receptor's ability to discriminate between losartan and PD123177, expecting poor discrimination as observed in native turkey receptors

  • Aldosterone production: In appropriate cell types, validate the receptor's ability to stimulate aldosterone production in response to angiotensin II

How can comparative studies of turkey versus mammalian AGTR1 inform GPCR evolution research?

The distinct pharmacological profile of turkey AGTR1 compared to mammalian AGTR1 provides a valuable model for evolutionary studies of GPCR function:

  • Ligand binding pocket evolution: Detailed structural comparisons can reveal evolutionary changes in ligand recognition domains that explain differential antagonist binding

  • Signal transduction conservation: Despite pharmacological differences, both avian and mammalian AGTR1 couple to calcium signaling, suggesting conservation of core signaling mechanisms

  • Receptor trafficking differences: The distinct internalization patterns (30% in turkey vs. different patterns in mammals) offer insights into the evolution of GPCR regulatory mechanisms

For researchers:

  • Design comparative binding studies with recombinant receptors from multiple species

  • Use site-directed mutagenesis to identify key residues responsible for species differences

  • Develop homology models based on crystal structures of related GPCRs to predict structural differences

What challenges exist in adapting established mammalian AGTR1 methodologies to turkey AGTR1 research?

Researchers transitioning from mammalian to turkey AGTR1 studies should anticipate several methodological challenges:

  • Antibody cross-reactivity: Commercial antibodies developed against mammalian AGTR1 may have reduced affinity for turkey AGTR1, necessitating development of species-specific antibodies

  • Antagonist selection: The poor discrimination between type-1 and type-2 antagonists in turkey AGTR1 limits the utility of standard pharmacological tools

  • Expression optimization: Codon usage and post-translational modification requirements may differ for optimal expression of turkey versus mammalian AGTR1

  • Functional assays: Standard assays may require adaptation to account for species-specific signaling kinetics and magnitudes

For researchers developing recombinant turkey AGTR1 systems:

  • Consider codon optimization for the expression system of choice

  • Validate multiple antibodies if using immunological detection methods

  • Develop turkey-specific positive controls for functional assays

  • Benchmark against native turkey adrenal cell responses when possible

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.