Recombinant Meleagris gallopavo Vasoactive intestinal polypeptide receptor (VIPR1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Meleagris gallopavo (wild turkey) vasoactive intestinal polypeptide receptor 1 (VIPR1) is a genetically engineered protein designed for research applications. VIPR1 belongs to the class B1 family of G protein-coupled receptors (GPCRs) and binds vasoactive intestinal peptide (VIP), a neuropeptide involved in smooth muscle relaxation, immune modulation, and endocrine regulation . Its recombinant form enables biochemical and functional studies in controlled experimental settings.

Gene and Protein Structure

  • Gene: VIPR1 (UniProt ID: Q91085) encodes a 457-amino acid protein in turkeys .

  • Domains:

    • N-terminal extracellular domain (critical for ligand binding).

    • Seven transmembrane helices (TM1–TM7) with intracellular loops involved in G protein coupling .

    • C-terminal cytoplasmic tail for signal transduction .

PropertyDetails
SpeciesMeleagris gallopavo (wild turkey)
Protein Length457 amino acids
Molecular Weight~52 kDa (predicted)
Expression SystemE. coli (common for recombinant production)
TagVaries (e.g., His-tag for purification)
Storage Conditions-20°C in Tris-based buffer with 50% glycerol

Receptor Activation Mechanism

  • Ligand Binding: VIP interacts with the N-terminal extracellular domain (N-ted) and transmembrane regions. Key residues (e.g., K143, T144, T147 in TM1) stabilize VIP binding and receptor activation .

  • Conformational Changes:

    • VIP binding disrupts interactions between helices 2, 3, and 7, enabling G protein coupling .

    • Mutagenesis studies highlight residues critical for cAMP signaling (e.g., H178R in TM2 causes constitutive activation) .

Functional Roles in Physiology

  • Immune Modulation:

    • Downregulated during T cell activation, suggesting a role in restraining excessive immune responses .

    • VIP/VPAC1 signaling inhibits CD8+ T cell expansion in Listeria infection models .

  • Reproductive Traits:

    • Polymorphisms in VIPR1 (e.g., C17687T, A17690T) correlate with egg production and broodiness in turkey hens .

Key Studies and Findings

Study FocusKey ResultsSource
Structural ModelingIdentified Q380 as a "ferry-boat" residue stabilizing receptor activation .Frontiers
Immune RegulationVIPR1 silencing during CD8+ T cell expansion reduces cAMP-mediated suppression .PMC
Polymorphism AnalysisNovel SNPs in VIPR1 linked to turkey reproductive performance .SciELO

Challenges and Future Directions

  • Structural Resolution: No experimental 3D structure exists; homology models remain critical for mechanistic studies .

  • Therapeutic Potential: VIPR1 agonists/antagonists could target immune disorders or reproductive management in poultry .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributors.
All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
VIPR1; Vasoactive intestinal polypeptide receptor; VIP receptor; VIP-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-457
Protein Length
Full Length of Mature Protein
Species
Meleagris gallopavo (Wild turkey)
Target Names
Target Protein Sequence
GLVVEVEVWWWRWRFGGGGCIMLEIEEERSQCPAEITEDNQTSGCRRQWDNITCWPEAQV GAVVVKPCPKYFRLLTTFLGNVSRNCTSQGWTDVYPAPYAVACGYDSTAHQGKEQTAFYG TVKTGYTIGHTLSLIALTAAMIILCLFRKLHCTRNYIHMHLFMSFIMRAIAVFIKDVTLF ESGEPEHCFVSSVGCKAMMVFFQYCVMANFFWLLVEGLYLHTLLVISFFSERKYFWWYIL IGWGAPSVFITAWTVVRIYFFNVGCWEEIIESPIWWIIKTPILVSILVNFILFICIIRIL VQKLHSPDVGHNETSQYSRLAKSTLLLIPLFGIHYIMFAFFPDNFKAQVKLVFELVVGSF QGFVVAVLYCFLNGEVQAELKRKWRRWHLERFLGSDMKYHHPSLGSNGTNFSTQISMLTK CSPKTRRCSSFQAEFSLV
Uniprot No.

Target Background

Function
This receptor serves as a binding site for vasoactive intestinal polypeptide (VIP). The receptor's activity is mediated by G proteins, which activate adenylyl cyclase.
Database Links

KEGG: mgp:100303683

UniGene: Mga.4437

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in pituitary, hypothalamus, small intestine and ovarian follicles.

Q&A

What is the molecular structure and classification of Meleagris gallopavo VIPR1?

VIPR1 (Vasoactive Intestinal Peptide Receptor-1) in turkeys is a glycoprotein belonging to the class II subfamily of 7-transmembrane G-protein-coupled receptors superfamily. The receptor is primarily located on the membrane surface of anterior pituitary cells in birds where it mediates the effects of VIP (Vasoactive Intestinal Peptide) . The turkey VIPR1 gene is structurally complex with multiple exons and introns, with documented polymorphisms particularly in intron regions that have been associated with reproductive traits .

How does VIPR1 function in the turkey neuroendocrine system?

VIPR1 functions as the primary receptor for VIP in the turkey neuroendocrine system, playing crucial roles in multiple physiological pathways. When VIP binds to VIPR1, it triggers signaling cascades that influence prolactin secretion from the anterior pituitary . This mechanism is particularly important in regulating reproductive behaviors including broodiness in avian species. Research demonstrates that VIPR1-mediated signaling affects gonadotropin-releasing hormone (GnRH) secretion, thus indirectly modulating gonadotropin levels and reproductive performance . Methodologically, the function of VIPR1 in turkeys has been studied through expression analysis in different tissues and through association studies linking genetic variations to phenotypic differences in reproductive traits.

What established methodologies are available for studying VIPR1 gene expression in avian tissues?

For investigating VIPR1 gene expression in avian tissues, several established methodologies have proven effective:

  • PCR amplification followed by single-strand conformation polymorphism (SSCP) analysis to detect SNPs in the VIPR1 gene, as demonstrated in studies of turkey reproductive traits .

  • DNA sequencing of variant fragments identified through SSCP to characterize specific mutations, particularly in intronic regions (e.g., C17687T and A17690T in intron 2) .

  • Quantitative real-time PCR to measure VIPR1 mRNA expression levels in different brain regions, similar to techniques used for VIP expression analysis in birds .

  • In situ hybridization techniques for visualizing regional expression patterns within specific tissues, particularly in hypothalamic regions .

For expression studies, researchers typically normalize VIPR1 expression against established housekeeping genes and account for covariates such as breeding stage, hormone levels, and other physiological parameters that might influence expression patterns.

How do polymorphisms in the VIPR1 gene correlate with reproductive traits in turkeys?

Research has identified specific polymorphisms in the VIPR1 gene that significantly correlate with reproductive traits in turkeys. Two notable SNPs in intron 2 of VIPR1 (C17687T and A17690T) have shown associations with egg production parameters . Statistical analysis revealed that the AA genotype of A17690T on intron 2 of VIPR1 was significantly associated with higher laying period (LP), egg number (EN), and total egg weight (TEW) .

The following table summarizes key associations between VIPR1 polymorphisms and reproductive traits in turkeys:

PolymorphismLocationAssociated TraitsFavorable Genotype/Allele
C17687TIntron 2Egg production traitsVariable
A17690TIntron 2LP, EN, TEWAA genotype
AGAA haplotypeCombinationHigher EN and TEW-

The mechanism through which these intronic polymorphisms affect reproductive traits likely involves altered gene expression or splicing efficiency rather than changes to the protein structure itself. These polymorphisms have potential application as marker-assisted selection (MAS) tools for improving egg production and reducing broodiness in turkey breeding programs .

What is the relationship between VIPR1 haplotypes and egg production metrics in avian species?

The relationship between VIPR1 haplotypes and egg production metrics has been established through association studies in multiple avian species. In turkeys specifically, the AGAA haplotype shows significant association with higher egg number (EN) and total egg weight (TEW) . This multi-SNP approach to analyzing genetic influence on egg production provides more comprehensive information than single SNP associations.

Research methodologies to establish these relationships typically involve:

  • Genotyping individuals for multiple SNPs within the VIPR1 gene

  • Constructing haplotypes using statistical algorithms

  • Recording comprehensive egg production metrics (EN, TEW, LP, AFE)

  • Performing association analyses with appropriate statistical models that account for environmental factors

The expression of VIPR1 has shown a positive correlation with broodiness in chickens and turkeys, directly affecting egg production . These haplotype associations suggest complex genetic interactions within the VIPR1 gene that collectively influence reproductive performance, possibly through altered gene expression patterns or interaction with other genes in related pathways.

How do VIPR1 polymorphisms compare between different avian species in their effects on reproduction?

Comparative studies reveal both similarities and differences in how VIPR1 polymorphisms affect reproduction across avian species:

  • In turkeys, intronic polymorphisms in VIPR1 (C17687T and A17690T) have been associated with egg production traits including laying period and egg number .

  • In chickens, VIPR1 polymorphisms have shown associations with incubation behavior and age at first egg, with specific polymorphisms (VIPR-1/HahI and VIPR-1/TaqI) investigated for their relationships to reproductive traits .

  • In quails, VIPR1 polymorphisms have also demonstrated associations with egg number, suggesting conservation of function across species .

Notably, while some studies found associations between VIPR1 polymorphisms and age at first egg in certain chicken breeds, others (including a study on Ga Noi chickens) found no significant association . This highlights species-specific and even breed-specific effects of VIPR1 variants.

The methodological approach to these comparative studies typically involves:

  • Targeted sequencing of homologous regions across species

  • Standardized phenotypic measurements

  • Statistical analyses that account for species-specific factors

  • Consideration of evolutionary relationships in interpreting results

These cross-species comparisons provide valuable insights into the conserved and divergent aspects of VIPR1 function in avian reproduction.

What is the mechanism of VIP-VIPR1 signaling in regulating prolactin secretion and broodiness?

The VIP-VIPR1 signaling pathway regulates prolactin secretion and broodiness through a multi-step process:

Experimental evidence supports this mechanism: active immunization against VIP in turkey hens terminates broodiness and increases egg production . Additionally, VIP antibody injections inhibit broodiness and reduce serum prolactin in incubating hens . The expression of VIPR1 shows positive correlation with broodiness in chickens and turkeys, directly affecting egg production .

This signaling pathway represents a critical target for genetic selection strategies aimed at reducing broodiness and improving egg production in commercial turkey lines.

How do interactions between VIP, VIPR1, and prolactin influence both immune and reproductive systems?

VIP and VIPR1 create a molecular bridge between immune and reproductive functions through multifaceted interactions:

Reproductive System Effects:

  • VIP stimulates prolactin secretion via VIPR1 receptors in the pituitary

  • Prolactin plays a causal role in parental behavior in birds

  • VIP immunoreactivity in the anterior hypothalamus correlates positively with aggression in various bird species

  • VIP neurons in the infundibular region project to the median eminence and stimulate hypophyseal secretion of prolactin

Immune System Effects:

  • VIP and its related peptide PACAP exert immunomodulatory (primarily anti-inflammatory) actions through VPAC1 (VIPR1) and VPAC2 receptors

  • These peptides can induce regulatory T cells (Tregs)

  • VIPR1-deficient mice show ameliorated experimental autoimmune encephalomyelitis (EAE), suggesting this receptor's involvement in inflammatory processes

  • VIPR1 knockout affects the upregulation of CNS chemokines and invasion of inflammatory cells into the CNS

The dual role of VIP-VIPR1 signaling in both systems suggests evolutionary conservation of these pathways. Methodologically, these interactions have been studied using gene knockout models, pharmacological manipulations, and molecular expression analyses across tissues.

What experimental approaches have been used to study VIPR1 function in vivo?

Multiple experimental approaches have been employed to investigate VIPR1 function in vivo:

  • Gene knockout models:

    • VIPR1 knockout (KO) mice have been created to study the receptor's function in immune responses, particularly in experimental autoimmune encephalomyelitis (EAE)

    • These models allow assessment of phenotypic changes in the complete absence of the receptor

  • Pharmacological manipulations:

    • VIPR1-specific antagonists like PG97-269 have been administered to mimic the effects of genetic VIPR1 deficiency

    • Treatment of wild-type mice with VIPR1 antagonists before EAE induction mimicked the clinical phenotype of VIPR1 KO mice

  • Active immunization against VIP:

    • Turkey hens have been immunized against VIP to assess effects on the VIP-VIPR1 pathway, demonstrating termination of broodiness and increased egg production

  • Adoptive transfer experiments:

    • Lymph node and spleen cells from EAE-induced wild-type and VIPR1 KO mice have been transferred to naïve recipients to assess immune cell function

    • These experiments help distinguish between effects of VIPR1 in different tissue compartments

  • Bone marrow chimeras:

    • Used to determine whether VIPR1 expression in the immune/hematopoietic compartment versus other tissues is responsible for observed phenotypes

Each of these approaches provides unique insights into VIPR1 function from different angles, collectively building a comprehensive understanding of this receptor's physiological roles.

What are the current techniques for producing recombinant Meleagris gallopavo VIPR1 protein for structural and functional studies?

Current techniques for producing recombinant Meleagris gallopavo VIPR1 follow established protocols for G protein-coupled receptors (GPCRs), with specific optimizations for this avian receptor:

  • Expression Systems Selection:

    • Mammalian expression systems (typically HEK293 or CHO cells) are preferred for proper post-translational modifications

    • Insect cell systems (Sf9, Sf21) using baculovirus vectors provide higher yields with some compromise on glycosylation patterns

    • Yeast systems (Pichia pastoris) offer advantages for large-scale production

  • Construct Optimization:

    • Addition of N-terminal signal sequences and C-terminal purification tags

    • Inclusion of stabilizing mutations or fusion partners (e.g., T4 lysozyme) in intracellular loop 3

    • Codon optimization for the expression host

  • Solubilization and Purification:

    • Careful detergent selection (typically DDM, LMNG, or MNG-3) for membrane extraction

    • Affinity chromatography using tags (His, FLAG, or biotin tags)

    • Size exclusion chromatography for final purification

  • Functional Verification:

    • Ligand binding assays using labeled VIP peptide

    • G protein coupling assays to verify signaling competence

    • Thermal stability assays to assess protein quality

These methodologies must account for VIPR1's nature as a class II GPCR with specific structural features. Successful production of recombinant turkey VIPR1 enables structural studies through X-ray crystallography or cryo-electron microscopy, as well as functional characterization through binding and signaling assays.

How can researchers reconcile contradictory findings on VIPR1 function across different experimental models?

Contradictory findings on VIPR1 function across experimental models can be reconciled through systematic methodological approaches:

  • Species-Specific Differences Analysis:

    • The search results reveal differences between avian and mammalian VIPR1 functions. For example, while VIPR1 is associated with reproductive traits in birds , VIPR1-deficient mice show ameliorated experimental autoimmune encephalomyelitis .

    • Researchers should conduct comparative genomic analyses to identify evolutionary divergences in receptor structure and signaling pathways.

  • Context-Dependent Function Evaluation:

    • VIPR1 function may vary based on tissue context. For instance, VIPR1 expression in the pituitary affects reproduction , while its expression in immune cells influences inflammatory responses .

    • Multi-tissue studies within the same experimental model can help identify tissue-specific roles.

  • Temporal Dynamics Consideration:

    • The timing of VIPR1 involvement may explain contradictions. In EAE studies, VIPR1 antagonist treatment before, but not after, disease induction mimicked the KO phenotype .

    • Time-course studies with conditional knockout models can clarify temporal aspects of VIPR1 function.

  • Integration of In Vivo and In Vitro Findings:

    • Discrepancies often arise between in vitro and in vivo results. For example, while VIP generally shows anti-inflammatory effects in vitro, VIP-deficient mice unexpectedly show resistance to EAE .

    • Parallel in vitro and in vivo studies within the same research program can help bridge these gaps.

  • Statistical Reassessment:

    • Some contradictions may result from statistical limitations. For example, while some studies found associations between VIPR1 polymorphisms and age at first egg in certain chicken breeds, others found no significant association .

    • Meta-analyses and larger sample sizes can help resolve such discrepancies.

Researchers should acknowledge that apparent contradictions may reflect the true biological complexity of VIPR1 function rather than experimental errors.

What are the emerging techniques for studying VIPR1 gene regulation in the context of turkey reproductive physiology?

Emerging techniques for studying VIPR1 gene regulation in turkey reproductive physiology combine advanced molecular approaches with traditional reproductive biology methods:

  • CRISPR-Cas9 Genome Editing:

    • Targeted modification of VIPR1 regulatory regions in turkey cell lines or embryos

    • Introduction of specific SNPs identified in association studies (e.g., C17687T and A17690T) to validate their functional effects

    • Creation of reporter constructs with fluorescent proteins driven by VIPR1 regulatory elements

  • Single-Cell Transcriptomics:

    • Analysis of VIPR1 expression at the single-cell level in pituitary and hypothalamic tissues

    • Identification of cell populations with differential VIPR1 expression during reproductive cycles

    • Correlation with co-expressed genes to map regulatory networks

  • Chromatin Immunoprecipitation Sequencing (ChIP-seq):

    • Identification of transcription factors binding to VIPR1 regulatory regions

    • Mapping of epigenetic modifications (histone marks, DNA methylation) associated with VIPR1 expression changes during reproductive states

    • Integration with DNase-seq or ATAC-seq data to identify accessible chromatin regions

  • Long-Read Sequencing:

    • Comprehensive characterization of all VIPR1 transcript isoforms in turkey tissues

    • Identification of novel splice variants associated with reproductive states

    • Detection of tissue-specific promoter usage and alternative polyadenylation sites

  • In Vivo Imaging:

    • Development of reporter systems to visualize VIPR1 expression in living tissues

    • Real-time monitoring of expression changes during reproductive cycle transitions

    • Correlation with behavioral and physiological parameters

These emerging techniques offer unprecedented resolution for understanding the complex regulatory mechanisms controlling VIPR1 expression in turkey reproductive physiology, potentially leading to novel breeding strategies and improved reproductive management in commercial turkey production.

How can VIPR1 genetic data be effectively incorporated into turkey breeding programs?

VIPR1 genetic data can be strategically incorporated into turkey breeding programs through multiple approaches:

  • Marker-Assisted Selection (MAS):

    • Identified SNPs in VIPR1 (C17687T and A17690T in intron 2) can be used as genetic markers

    • Selection for favorable alleles associated with higher laying period (LP), egg number (EN), and total egg weight (TEW)

    • Implementation of haplotype-based selection, particularly for the AGAA haplotype that shows association with higher EN and TEW

  • Genomic Selection Models:

    • Integration of VIPR1 polymorphisms into broader genomic selection indices

    • Weighting of VIPR1 markers based on their effect sizes on reproductive traits

    • Development of customized SNP arrays that include VIPR1 variants alongside other reproduction-associated markers

  • Genetic Diversity Management:

    • Monitoring VIPR1 allele frequencies in breeding populations to maintain genetic diversity

    • Strategic introduction of beneficial VIPR1 alleles from heritage or wild turkey populations

    • Prevention of genetic drift that might eliminate valuable VIPR1 variants

  • Validation and Refinement Protocol:

    • Initial small-scale validation trials in diverse genetic backgrounds

    • Systematic phenotypic assessment of reproductive parameters

    • Iterative refinement of selection strategies based on performance data

This integrated approach utilizes VIPR1 genetic information as one component of a comprehensive breeding strategy, recognizing that reproductive traits are influenced by multiple genes and environmental factors. The implementation should be tailored to specific breeding objectives and population genetic structures.

What are the implications of VIPR1 research for understanding reproductive disorders in avian species?

VIPR1 research has significant implications for understanding reproductive disorders in avian species:

  • Molecular Basis of Broodiness:

    • VIPR1 expression shows positive correlation with broodiness in chickens and turkeys

    • Understanding this molecular mechanism provides insight into both normal reproductive cycling and persistent broodiness, a common disorder in commercial poultry

  • Egg Production Abnormalities:

    • VIPR1 polymorphisms are associated with egg production traits including laying period and egg number

    • This connection helps explain genetic components of disorders such as early cessation of laying and irregular egg production patterns

  • Hormonal Dysregulation Mechanisms:

    • VIPR1 mediates VIP's effects on prolactin secretion , a key hormone in reproductive behavior

    • Disruptions in this pathway may explain instances of hormonal imbalances observed in reproductive disorders

  • Genetic Risk Factors:

    • Specific VIPR1 genotypes and haplotypes associated with suboptimal reproductive performance may serve as genetic risk markers

    • These markers could help identify birds predisposed to reproductive disorders before they manifest

  • Comparative Pathophysiology:

    • Differences in VIPR1 function across avian species provide evolutionary context for species-specific reproductive disorders

    • This comparative approach may reveal conserved vulnerability points in reproductive regulation

The research findings on VIPR1's role in reproductive physiology provide a molecular framework for diagnosing, preventing, and potentially treating reproductive disorders in commercially important avian species, with particular relevance to the turkey industry.

How might research on turkey VIPR1 inform broader understanding of neuropeptide receptor evolution?

Research on turkey VIPR1 offers valuable insights into neuropeptide receptor evolution across vertebrates:

This evolutionary perspective on turkey VIPR1 contributes to broader understanding of how neuropeptide signaling systems adapt to species-specific physiological demands while maintaining essential functions across vertebrate lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.