Recombinant Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Membrane Protein Insertase YidC

Recombinant membrane protein insertase YidC (YidC) is a conserved bacterial membrane protein critical for the insertion and folding of newly synthesized membrane proteins. In Escherichia coli, YidC operates either independently as a Sec-independent insertase or synergistically with the SecYEG translocon during co-translational membrane protein biogenesis . Recombinant YidC, produced via heterologous expression and purification, retains its functional properties, enabling detailed mechanistic studies .

Sec-Independent Insertion

YidC autonomously inserts small, single-spanning membrane proteins (e.g., Pf3 coat, M13 procoat) through a two-step process:

  1. Binding: The cytoplasmic α-helical hairpin captures substrates within 2 ms, exhibiting high conformational flexibility .

  2. Insertion: The hydrophilic groove guides substrates into the membrane via salt bridges (e.g., R72-D7/D18 in Pf3) and hydrophobic interactions .

Conformational changes in YidC’s TM helices widen the groove by >10°, enabling substrate accommodation . Hydration-dehydration cycles within the groove further assist translocation .

SecYEG-Dependent Insertion

YidC collaborates with the Sec translocon for polytopic or complex membrane proteins (e.g., LacY permease, cytochrome o oxidase) . Here, YidC acts as a chaperone, stabilizing transmembrane domains (TMDs) exiting SecYEG’s lateral gate .

Substrate Specificity

YidC recognizes substrates based on:

  • Charge complementarity: Negatively charged regions in substrates (e.g., Pf3 D7/D18) bind YidC’s positively charged groove .

  • Hydrophobicity: Moderate hydrophobicity thresholds enable YidC-assisted insertion .

  • Topology: Single-TMD proteins (e.g., F0c, MscL) are Sec-independent, while multi-TMD proteins require SecYEG .

In Vitro Reconstitution

  • Purified YidC inserts Pf3 coat into proteoliposomes at a catalytic rate of ~150 substrates per YidC molecule .

  • Mutations in the hydrophilic groove (e.g., YidC-5S) disrupt SecYEG interaction but spare Sec-independent insertion .

Functional Interactors

  • YibN: A novel interactor that enhances YidC-mediated insertion of Pf3, M13, and F0c by 1.5–1.8-fold .

  • SecDF: Modulates YidC’s periplasmic domain during SecYEG-dependent folding .

Applications and Implications

  1. Antibiotic Development: YidC’s essential role in bacterial membrane biogenesis makes it a target for novel antibiotics .

  2. Synthetic Biology: Engineered YidC variants could improve membrane protein production for structural studies .

  3. Evolutionary Insights: Conservation across bacteria, mitochondria (Oxa1), and chloroplasts (Alb3) underscores its fundamental role .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific requirements. If you have a preference for a particular format, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for the most accurate delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products can be influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please communicate it to us, and we will prioritize the development of your specified tag.
Synonyms
yidC; ML2710; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
yidC
Target Protein Sequence
MSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVFTLRALLYKPF VRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVF LGLYHALRSFNRTTGGFGQPHMSVTENRMTGNYVFTPVDVGHFLDANLWGAPIGAYMTQR SGLDAFIDFSRPAVILVGIPMMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYV FPFGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATTPADKPDCVGY NNNPTSHTRRSGQRTKRRKR
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Contributes to the folding of multispanning membrane proteins.
Database Links

KEGG: mle:ML2710

STRING: 272631.ML2710

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of YidC in bacterial cells?

YidC functions as a membrane insertase that catalyzes the integration of membrane proteins into the lipid bilayer. Specifically, YidC recognizes hydrophobic regions of newly synthesized membrane proteins and facilitates their proper orientation within the membrane. It plays a crucial role in the insertion process of membrane proteins that do not require the classical Sec machinery (Sec-independent pathway), but it also works in conjunction with the Sec translocase for Sec-dependent substrates . The 61 kDa YidC protein in Escherichia coli is specifically used for membrane protein insertion and not for the translocation of exported proteins . Functionally, YidC can be considered a membrane chaperone that supports folding reactions within the membrane by providing an amphiphilic surface that allows the transfer of polar regions of translocating proteins .

How does YidC differ from other membrane protein insertion mechanisms?

Unlike the classical Sec translocase pathway which forms a channel for protein translocation, YidC appears to function as a membrane chaperone that assists in the folding and insertion of proteins directly into the lipid bilayer. While the Sec machinery typically handles proteins with large periplasmic domains, YidC can independently insert proteins with small periplasmic regions, such as the single-spanning Pf3 coat protein or the double-spanning M13 procoat protein .

Mechanistically, YidC interacts with the hydrophobic parts of substrate proteins and shields the hydrophilic regions from the lipid phase during translocation . This differs from the Sec translocase which forms a protected channel. Additionally, while YidC homologues exist in mitochondria (Oxa1p) and chloroplasts (Alb3), mitochondria lack Sec translocase components entirely, highlighting the evolutionary importance of YidC-like proteins as a distinct insertion pathway .

What is the relationship between YidC and the SecYEG translocon?

YidC has a complex functional relationship with the SecYEG translocon. While YidC can function independently, it also works cooperatively with the Sec machinery. YidC has been found to copurify with SecYEGDF, indicating a physical association . In the case of Sec-dependent membrane proteins like FtsQ, nascent chains first contact SecY and subsequently interact with YidC, demonstrating a sequential process of membrane insertion .

The stoichiometry between these components is important to consider in experimental design—YidC is approximately five times more abundant than the SecYEG complex in bacterial cells . This relationship can be observed experimentally through cross-linking studies, where efficient SecYEG-YidC complex formation is visualized only when SecYEG and YidC are present at approximately equal concentrations . Specific interaction sites have been identified, with cross-linking products observed for YidC variants containing pBpa (p-benzoyl-L-phenylalanine) at positions V15 and D399 when co-expressed with SecYEG .

What are the optimal expression systems for recombinant YidC production?

For efficient YidC expression, a co-expression system that allows simultaneous expression of YidC and SecYEG provides significant advantages over single protein expression systems. Research demonstrates that expression from plasmids such as pBad24-YidC yields substantial protein, but the relative concentration of YidC compared to SecYEG affects complex formation and functional studies .

For studies involving amber suppression techniques with pBpa incorporation, it's crucial to supplement the growth medium with pBpa to achieve efficient full-length protein expression. Without pBpa addition, translation stops at the amber codon, resulting only in truncated YidC variants . The expression system should be designed to allow IPTG-dependent SecYEG production, which enables researchers to control the relative concentrations of YidC and SecYEG. This controlled expression is particularly important for cross-linking studies, as detection of YidC-SecYEG complexes is most efficient when these components are present at approximately equimolar concentrations .

What purification strategies yield functional YidC for reconstitution experiments?

While the search results don't provide explicit purification protocols, they demonstrate that functional YidC has been successfully purified and reconstituted into proteoliposomes. The purified YidC maintains its insertase activity, as evidenced by its ability to facilitate the membrane integration of the Pf3 coat protein .

For purification, affinity chromatography using an N-terminal His-tag on YidC has been utilized successfully, as demonstrated in cross-linking experiments where this tag was used to isolate YidC-containing complexes . When designing purification strategies, researchers should consider maintaining the native conformation of YidC, particularly its transmembrane domains and the large periplasmic domain between the first two transmembrane regions that is critical for function and interactions .

After purification, the activity of YidC can be verified through functional reconstitution assays using model substrate proteins like the Pf3 coat protein .

How should researchers approach YidC reconstitution into proteoliposomes?

Reconstitution of YidC into proteoliposomes requires careful consideration of protein:lipid ratios. Experimental data indicates that a protein:lipid ratio of 1:25,000 (approximately 25 YidC molecules per liposome) provides optimal efficiency for membrane insertion activities . At lower concentrations (fewer than 5 molecules per liposome, or a protein:lipid ratio of 1:200,000), insertion efficiency decreases significantly . Interestingly, increasing YidC density beyond optimal levels (up to 120 molecules per liposome, or a protein:lipid ratio of 1:5,000) slightly decreases insertion efficiency .

When preparing proteoliposomes, researchers should verify the orientation of reconstituted YidC. This can be accomplished using protease protection assays with specific antibodies directed against different YidC domains. In previous studies, trypsin treatment of YidC proteoliposomes generated a 42 kDa fragment recognized by antibodies directed against a periplasmic YidC peptide, indicating that most YidC molecules were oriented with the large periplasmic domain inside the proteoliposomes (inverted orientation) .

The functional integrity of reconstituted YidC should be assessed through insertion assays using purified substrate proteins such as the Pf3 coat protein, measuring the protection from proteinase K as an indicator of successful membrane insertion .

What experimental approaches best demonstrate YidC insertase activity?

The gold standard for demonstrating YidC insertase activity is the reconstitution of purified YidC into proteoliposomes followed by membrane insertion assays using purified substrate proteins. The Pf3 coat protein serves as an excellent model substrate, as it requires YidC for efficient membrane insertion .

In a typical assay, purified Pf3 coat protein is incubated with YidC proteoliposomes, and membrane insertion is assessed by protease protection - correctly inserted protein is protected from proteinase K digestion when the proteoliposomes remain intact, but becomes accessible to digestion when the membranes are disrupted with detergent . This approach allows for quantitative assessment of insertion efficiency.

The kinetics of insertion can be monitored by taking time points during the insertion reaction and measuring the amount of protease-protected protein. In YidC-containing proteoliposomes, efficient insertion of the Pf3 coat protein occurs within minutes . Comparative studies with liposomes lacking YidC serve as important controls to demonstrate YidC-specific effects .

How can researchers analyze the YidC-SecYEG interaction in molecular detail?

Site-specific cross-linking approaches using unnatural amino acids like p-benzoyl-L-phenylalanine (pBpa) provide powerful tools for analyzing YidC-SecYEG interactions at the molecular level. Key interaction sites have been identified by incorporating pBpa at specific positions in YidC, such as V15 and D399 . Upon UV exposure, pBpa forms covalent bonds with nearby molecules, allowing for the capture of transient protein-protein interactions.

For effective cross-linking studies of YidC-SecYEG interactions, co-expression systems that allow for comparable expression levels of both components are critical. Experimental evidence shows that cross-linking products between YidC and SecY (appearing as ~95 kDa bands on immunoblots) are efficiently detected only when SecYEG is co-expressed with YidC at roughly equimolar concentrations .

After cross-linking, complexes can be purified via affinity tags (such as His-tags on YidC) and analyzed by immunoblotting with antibodies against interaction partners like SecY . For definitive identification of cross-linked products, mass spectrometry analysis can be employed to confirm the identity of the components and potentially identify the exact residues involved in the interaction.

What methods can determine substrate specificity of YidC?

Substrate specificity of YidC can be investigated using comparative insertion assays with different potential substrate proteins. A particularly informative approach is the comparison of wild-type substrate proteins with mutant variants. For example, studies with the Pf3 coat protein and its mutant variant 3L-Pf3 (containing an extended hydrophobic region) revealed distinct YidC dependencies .

In vivo, YidC dependency can be assessed using YidC depletion strains like JS 7131, where YidC expression is under the control of an inducible promoter (e.g., araBAD) . By comparing the membrane insertion of potential substrates under YidC-depleted and YidC-expressing conditions, researchers can determine whether a protein requires YidC for insertion.

In vitro, reconstitution experiments with proteoliposomes containing or lacking YidC allow for direct comparison of insertion efficiencies. The kinetics of insertion can provide valuable insights - even for substrates that can insert independently of YidC (like 3L-Pf3), YidC may accelerate the insertion process, suggesting a catalytic rather than an absolute requirement .

How does the membrane potential (ΔΨ) influence YidC-mediated protein insertion?

This discrepancy resembles observations with Sec-mediated protein translocation, where a transmembrane potential is not required in reconstituted systems despite its importance in vivo . The 3L-Pf3 mutant with an extended hydrophobic region inserts efficiently even without a membrane potential, both in membrane vesicles and in liposomes .

These findings suggest that the membrane potential may play a regulatory role rather than being mechanistically essential for YidC function in vitro. Researchers investigating the role of membrane potential should design experiments that compare insertion efficiencies in energized versus non-energized membrane systems, while considering that substrate properties (particularly hydrophobicity) significantly influence potential dependency .

What is the catalytic mechanism of YidC-mediated membrane insertion?

The catalytic mechanism of YidC appears to involve several distinct steps. Initially, substrate proteins hydrophobically interact with the membrane in the absence of YidC, resulting in partial partitioning into the membrane bilayer without complete translocation of hydrophilic domains . YidC then catalyzes two critical processes: the translocation of hydrophilic domains across the membrane and the folding of hydrophobic regions into proper transmembrane configurations .

Functionally, YidC acts as a membrane chaperone, supporting protein folding within the membrane environment. This is achieved through direct interactions with the hydrophobic parts of substrate proteins (demonstrated by cross-linking studies) and by providing an amphiphilic surface that shields hydrophilic regions of the translocating protein from the lipid phase .

The catalytic nature of YidC is evidenced by insertion assays showing that each YidC molecule can facilitate the insertion of approximately 150 Pf3 coat protein molecules, indicating multiple turnover events rather than a stoichiometric requirement . This suggests that YidC temporarily binds to substrate proteins, catalyzes their proper membrane insertion, and then releases them to engage with new substrates.

How do YidC homologs in different organisms compare functionally?

While the search results don't provide comprehensive comparative data on YidC homologs, they indicate that YidC-like proteins exist across diverse organisms and organelles. The mitochondrial Oxa1p and chloroplast Alb3 proteins are evolutionarily related to bacterial YidC and perform similar functions in membrane protein insertion .

A notable difference exists in the cellular context of these homologs: mitochondria lack Sec translocase components entirely, making Oxa1p solely responsible for inserting proteins from the matrix into the mitochondrial inner membrane . This contrasts with bacterial YidC, which functions both independently and in conjunction with the Sec machinery.

These evolutionary relationships suggest that the YidC/Oxa1p/Alb3 protein family represents an ancient and conserved mechanism for membrane protein insertion that predates the evolution of the more complex Sec machinery. Researchers interested in comparative studies should consider these contextual differences when designing experiments and interpreting results across different systems.

Why might cross-linking experiments fail to detect YidC-SecYEG interactions?

Failed detection of YidC-SecYEG interactions in cross-linking experiments can stem from several factors. Most critically, the relative stoichiometry between YidC and SecYEG significantly impacts detection sensitivity. Research demonstrates that cross-linking products between YidC and SecY are efficiently observed only when these components are present at approximately equimolar concentrations . Since YidC is naturally about five times more abundant than SecYEG in bacterial cells, using plasmid-encoded SecYEG to increase its concentration relative to YidC is essential for detecting these interactions .

The specific positions chosen for cross-linker incorporation also greatly affect results. Even subtle changes in the orientation of cross-linkers like pBpa can significantly impact cross-linking efficiency . Researchers should target multiple positions within YidC, particularly focusing on regions like V15 and the C1 loop (including position D399), which have demonstrated successful cross-linking to SecY .

Additionally, the cross-linking method itself matters - UV-dependent cross-linking with pBpa incorporated at specific positions has proven effective for capturing YidC-SecYEG interactions . The transient nature of these interactions may require optimization of cross-linking conditions, including UV exposure time and intensity.

What factors influence the efficiency of YidC reconstitution into proteoliposomes?

Several factors critically influence the efficiency of YidC reconstitution into proteoliposomes. The protein:lipid ratio is particularly important - experimental data shows that a ratio of 1:25,000 (approximately 25 YidC molecules per liposome) provides optimal insertion activity, while both lower and higher densities reduce efficiency .

The orientation of reconstituted YidC affects its functionality. Analysis of YidC proteoliposomes revealed that most YidC molecules adopt an inverted orientation with the large periplasmic domain located inside the proteoliposomes . This orientation should be verified using protease protection assays with domain-specific antibodies to ensure proper experimental interpretation.

The lipid composition of proteoliposomes likely influences YidC activity, though the search results don't specify optimal lipid mixtures. Researchers should consider using lipid compositions that mimic the native bacterial membrane environment or systematically test different lipid compositions to optimize reconstitution efficiency.

The presence or absence of a membrane potential may affect some aspects of YidC function, though in vitro studies suggest that YidC-mediated insertion of Pf3 coat protein occurs mainly independently of membrane potential . Nevertheless, researchers may want to establish methods for generating membrane potentials across proteoliposomes for comprehensive functional studies.

How can researchers distinguish between YidC-dependent and YidC-independent membrane insertion pathways?

Distinguishing between YidC-dependent and YidC-independent insertion pathways requires careful experimental design. A combination of in vivo and in vitro approaches provides the most comprehensive assessment:

In vivo, conditional YidC depletion strains (such as JS 7131 with arabinose-controlled YidC expression) allow researchers to monitor membrane insertion under YidC-depleted versus YidC-expressing conditions . Proteins that show severely reduced insertion during YidC depletion are considered YidC-dependent, while those that insert efficiently regardless of YidC levels utilize YidC-independent pathways.

Substrate properties, particularly hydrophobicity, strongly influence YidC dependency. Comparing wild-type proteins with mutants containing extended hydrophobic regions (as in the Pf3 vs. 3L-Pf3 comparison) can reveal how specific protein features determine insertion pathway requirements . Generally, proteins with highly hydrophobic transmembrane segments are more likely to insert independently of YidC, while those with less hydrophobic segments require YidC assistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.