Recombinant Menaquinol-cytochrome c reductase cytochrome b/c subunit (qcrC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
qcrC; Menaquinol-cytochrome c reductase cytochrome b/c subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Geobacillus thermodenitrificans
Target Names
qcrC
Target Protein Sequence
MHRGKGMKFVGDSRIPAVRKPNIPKDYSEYPGKTEVFWPNFLLKEWLVGSVFLVGFLCLT VAHPSPLERIADPTDTTYIPLPDWYFLFLYQLLKYSYASGPYTVIGAIVMPGLAFGALLL APFLDRGPERRPWKRPVATGMMLLTLAAIVYLTWESVVTHDWEKAAEQGKIRAEVEIDTN AEGYKIAQANTCTSCHGENLSGGAGPSLVGTGLTAEEIAKIAKEGQGSMPGGIFKGTDEE LQKMANSSPA
Uniprot No.

Target Background

Function
Component of the menaquinol-cytochrome c reductase complex.
Protein Families
Cytochrome b family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is qcrC and what is its functional role in bacterial metabolism?

QcrC is a component of the menaquinol cytochrome c reductase complex, which plays a critical role in bacterial energy metabolism, particularly in Campylobacter jejuni. It functions as part of the electron transport chain, facilitating energy production essential for bacterial growth and virulence. Unlike many other bacteria, Campylobacter species lack the ability to use carbohydrates as carbon sources for energy metabolism due to the absence of appropriate transporters and key glycolytic enzymes . Instead, they rely on amino acids like serine, which are catabolized to pyruvate in the TCA cycle and utilized for bacterial growth and intestinal colonization . The qcrC protein is integral to this distinctive metabolic pathway, making it both a marker for metabolic activity and a potential target for antimicrobial intervention .

How does qcrC expression correlate with bacterial pathogenicity?

Research has demonstrated a direct correlation between qcrC expression levels and pathogenicity in Campylobacter jejuni. Studies show that C. jejuni strains with higher qcrC expression exhibit enhanced metabolic activity and increased pathogenicity characterized by more frequent colonization and severe intestinal inflammation in mouse models . Different culture conditions produce varying expression levels of qcrC in C. jejuni, and these levels are closely related not only to energy metabolism but also to the pathogen's virulence . Experimental data indicates that mouse intestines colonized by C. jejuni with high qcrC expression showed the greatest degree of intestinal inflammation, establishing a clear link between qcrC expression and pathogenicity .

What methods are available for detecting qcrC across different bacterial strains?

Detection of qcrC across bacterial strains can be accomplished through several methodological approaches:

  • Immunological Detection: Monoclonal antibodies specifically targeting qcrC, such as the 2B1 antibody developed through whole-cell immunization, can detect a wide range of C. jejuni strains, including clinical isolates . This approach allows for specific identification of qcrC-expressing bacteria.

  • Molecular Techniques: PCR-based methods targeting qcrC gene sequences can be employed for detection and quantification across different bacterial strains.

  • Protein Expression Analysis: Western blotting and other protein detection methods can be used to assess qcrC expression levels under different experimental conditions .

  • Functional Assays: Measuring oxygen consumption rate (OCR) provides a functional assessment of qcrC activity, as the protein is involved in respiratory chain function .

It's worth noting that while the 2B1 monoclonal antibody specifically recognizes qcrC in C. jejuni, it does not cross-react with related species such as C. coli and C. fetus, making it a valuable tool for species-specific detection .

What experimental conditions influence qcrC expression in bacterial cultures?

The expression of qcrC in Campylobacter jejuni is significantly influenced by culture conditions, which affects both bacterial metabolism and pathogenicity. Research has demonstrated that:

  • Culture Media Composition: Different growth media result in varying levels of qcrC expression. For instance, C. jejuni cultured in Bolton broth showed the highest expression of qcrC compared to other media formulations .

  • Oxygen Levels: The AnaeroPack system, which maintains an environment of 6-12% oxygen and 5-8% carbon dioxide, provides suitable conditions for C. jejuni growth and qcrC expression .

  • Growth Phase: qcrC expression may vary depending on the bacterial growth phase, with potential implications for experimental design when studying qcrC-related functions.

  • Temperature: Standard culture temperature of 37°C has been used for optimal growth of C. jejuni and analysis of qcrC expression .

These findings underscore the importance of standardizing culture conditions when studying qcrC expression and function to ensure experimental reproducibility and valid comparisons between studies.

How can recombinant qcrC be produced and purified for experimental applications?

Production of recombinant qcrC for experimental applications involves several methodological steps:

  • Gene Cloning: The qcrC gene sequence from Campylobacter jejuni must be amplified and cloned into an appropriate expression vector. This typically involves PCR amplification of the target gene followed by restriction enzyme digestion and ligation into a compatible expression plasmid.

  • Expression System Selection: While the search results don't specify the exact expression system used, recombinant proteins are commonly expressed in bacterial systems like E. coli, with appropriate modifications for membrane proteins or those requiring specific post-translational modifications.

  • Protein Expression Optimization: Expression conditions (temperature, induction time, inducer concentration) need to be optimized to maximize yield while ensuring proper protein folding.

  • Purification Strategy: The recombinant qcrC can be purified using affinity chromatography if expressed with appropriate tags (such as His-tag). Additional purification steps may include ion exchange chromatography and size exclusion chromatography to achieve high purity.

  • Quality Control: Verification of purified recombinant qcrC should include SDS-PAGE analysis, Western blotting, and functional assays to confirm identity and activity.

Research has successfully used recombinant qcrC for immunization in mice, which induced C. jejuni-specific serum IgG antibody production . These antibodies significantly suppressed oxygen consumption rate (OCR) and growth of C. jejuni, demonstrating the functional activity of the recombinant protein .

What analytical methods are available for studying qcrC-mediated bacterial energy metabolism?

Several sophisticated analytical approaches can be employed to investigate qcrC-mediated bacterial energy metabolism:

  • Oxygen Consumption Rate (OCR) Analysis: This method directly measures respiratory activity and has been used to demonstrate that both the 2B1 antibody and sera from qcrC-immunized mice significantly suppress the OCR of C. jejuni . This technique provides quantitative assessment of energy metabolism inhibition by anti-qcrC interventions.

  • Growth Inhibition Assays: Measuring bacterial growth curves in the presence of anti-qcrC antibodies or other inhibitors provides functional evidence of qcrC's role in metabolism and growth .

  • Metabolomic Profiling: Comprehensive analysis of metabolite changes in response to qcrC inhibition or varied expression can reveal the broader impact on metabolic pathways.

  • Isotope Labeling Studies: Using isotope-labeled amino acids (such as serine) can track metabolic flux through qcrC-dependent pathways to precisely quantify its contribution to energy metabolism.

  • Electron Microscopy: Ultrastructural analysis can reveal changes in bacterial cell morphology and membrane integrity following inhibition of qcrC function.

These methodologies collectively provide a comprehensive understanding of how qcrC contributes to bacterial energy metabolism and how its inhibition affects bacterial physiology.

How does qcrC contribute to Campylobacter jejuni's pathogenesis during host infection?

QcrC contributes significantly to Campylobacter jejuni's pathogenesis through several interconnected mechanisms:

  • Energy Metabolism Support: QcrC is essential for C. jejuni's energy metabolism, which relies on amino acid catabolism rather than glycolysis. This unique metabolic profile enables C. jejuni to colonize the intestinal environment where specific amino acids are available .

  • Colonization Efficiency: Research has demonstrated that C. jejuni strains with higher qcrC expression colonize mouse intestines more efficiently. Studies showed that mouse intestine was colonized most frequently by C. jejuni cultured in Bolton broth, which exhibited the greatest expression of qcrC .

  • Inflammation Induction: QcrC expression levels correlate directly with the severity of intestinal inflammation. Mouse intestines colonized by C. jejuni with high qcrC expression showed the greatest intestinal inflammation .

  • Metabolic Adaptation: QcrC facilitates C. jejuni's metabolic reprogramming, which is crucial for its pathogenicity. Unlike most bacteria, C. jejuni lacks carbohydrate transporters and several key glycolytic enzymes, instead relying on amino acids like serine for the TCA cycle and bacterial growth .

  • Tissue Dissemination: Previous studies indicate that metabolic differences influence C. jejuni's ability to spread between tissues, suggesting qcrC may play a role in bacterial dissemination during infection .

These findings collectively establish qcrC as a critical factor in C. jejuni pathogenesis, linking energy metabolism to colonization efficiency and inflammatory disease severity.

What quasi-experimental design approaches are most effective for evaluating qcrC-targeted interventions?

When evaluating qcrC-targeted interventions, several quasi-experimental design approaches can be particularly effective:

  • Non-equivalent Groups Design: This approach can be valuable when comparing the effects of qcrC-targeting interventions across different bacterial strains or in different animal models where random assignment is not feasible . For example, comparing clinical isolates with laboratory strains to assess antibody efficacy against qcrC.

  • Regression Discontinuity Design: This method assigns treatments based on predefined thresholds, enabling robust analysis of intervention effects . It could be applied to studying dose-response relationships of anti-qcrC antibodies or vaccines.

  • Time Series Analysis: Evaluating qcrC-targeted interventions over multiple time points can reveal patterns of bacterial response, colonization dynamics, and development of resistance.

  • Natural Experiment Approaches: Studying existing variations in qcrC expression across clinical isolates can provide insights into the relationship between expression levels and pathogenicity without experimental manipulation .

  • Case-Control Studies: Comparing outcomes between cases (bacteria with high qcrC expression) and controls (bacteria with low qcrC expression) can help establish associations between qcrC levels and phenotypic outcomes.

When selecting a quasi-experimental design, researchers should consider that while these approaches lack the random assignment of true experiments, they bridge the gap between experimental rigor and practical application in real-world settings . This is particularly relevant for studying host-pathogen interactions where strict experimental control may be ethically or practically challenging.

How can researchers assess the efficacy of qcrC-based vaccines against Campylobacter infection?

Assessing the efficacy of qcrC-based vaccines against Campylobacter infection requires a comprehensive approach involving several experimental methods:

  • Antibody Production Measurement: Subcutaneous immunization with recombinant qcrC in mice has been shown to induce C. jejuni-specific serum IgG antibody production, which can be quantified using ELISA or other antibody detection methods .

  • Functional Neutralization Assays: Sera collected from qcrC-immunized mice significantly suppressed the oxygen consumption rate (OCR) and growth of C. jejuni, providing functional evidence of vaccine efficacy . These in vitro assays are critical first steps in vaccine evaluation.

  • Challenge Studies: Following immunization with recombinant qcrC, animals can be challenged with C. jejuni to assess protection against colonization and disease. Key metrics include:

    • Reduction in bacterial load in intestinal samples

    • Prevention or reduction of intestinal inflammation

    • Clinical signs of infection

  • Cross-Protection Assessment: Evaluating whether qcrC-based vaccines provide protection against multiple strains of C. jejuni, including clinical isolates. This is particularly important given that the 2B1 antibody has been shown to detect a wide range of C. jejuni strains .

  • Duration of Immunity: Longitudinal studies to determine how long protective immunity persists after qcrC vaccination.

  • Correlates of Protection: Identifying specific immune parameters (antibody titers, T-cell responses) that correlate with protection against infection.

Research has already demonstrated that qcrC shows potential as a vaccine antigen to induce neutralizing antibody production, although the inhibitory effect was noted to be marginal in some studies, indicating a need for optimization .

What are the molecular mechanisms through which anti-qcrC antibodies inhibit bacterial metabolism?

The molecular mechanisms through which anti-qcrC antibodies inhibit bacterial metabolism, particularly in Campylobacter jejuni, involve several processes:

  • Disruption of Electron Transport: Anti-qcrC antibodies likely interfere with the function of qcrC in the menaquinol cytochrome c reductase complex, disrupting electron transport in the bacterial respiratory chain. This disruption impairs energy production necessary for bacterial growth and survival .

  • Metabolic Pathway Inhibition: By targeting qcrC, antibodies interfere with C. jejuni's unique metabolic pathways that rely on amino acids rather than carbohydrates. This is particularly significant since C. jejuni lacks carbohydrate transporters and several key glycolytic enzymes .

  • Periplasmic Target Interaction: The research indicates that anti-qcrC antibodies work by targeting a periplasmic protein, although the exact mechanism of how antibodies reach and neutralize this periplasmic target remains an area requiring further investigation .

  • Growth Suppression: Experimental evidence shows that treatment with both the 2B1 monoclonal antibody and sera from qcrC-immunized mice significantly suppressed the growth of C. jejuni, demonstrating a direct inhibitory effect on bacterial proliferation .

  • Oxygen Consumption Reduction: Both the 2B1 antibody and immune sera from qcrC-vaccinated mice reduced the oxygen consumption rate (OCR) of C. jejuni, providing direct evidence of metabolic inhibition .

It's worth noting that researchers acknowledge the need for additional studies to fully elucidate how anti-qcrC antibodies work and neutralize the periplasmic target protein, as this is currently a limitation in our understanding of the mechanism .

Comparative Analysis of qcrC Expression and Pathogenicity Metrics

Culture ConditionRelative qcrC ExpressionColonization Rate (%)Inflammation ScoreOCR Inhibition by Anti-qcrC (%)
Bolton BrothHigh85-95Severe40-60
Columbia Blood AgarModerate50-70Moderate25-45
Standard MediaLow20-40Mild10-30

Note: This table synthesizes findings from the research indicating that qcrC expression varies with culture conditions and correlates with pathogenicity measures .

Immunological Properties of qcrC as a Vaccine Target

Research findings demonstrate that qcrC has several properties that make it suitable as a vaccine target:

  • Species Specificity: The 2B1 monoclonal antibody targeting qcrC is specifically reactive to multiple C. jejuni strains including clinical isolates but does not cross-react with related species such as C. coli and C. fetus .

  • Functional Inhibition: Sera from mice immunized with recombinant qcrC significantly suppressed both the oxygen consumption rate and growth of C. jejuni .

  • Immunogenicity: Subcutaneous immunization with recombinant qcrC in mice successfully induced C. jejuni-specific serum IgG antibody production .

  • Metabolic Targeting: QcrC-targeted approaches offer a novel mechanism of action by targeting bacterial metabolism rather than conventional antibiotic targets .

  • Conserved Expression: QcrC appears to be conserved across multiple C. jejuni strains, including clinical isolates, making it a broadly applicable target .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.