Recombinant Mercuric transport protein (merT)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Mercuric Transport Protein (MerT) is a 116-amino acid inner membrane protein encoded by mercury resistance operons such as Tn21 and Tn501 . It is overexpressed in heterologous systems like E. coli for structural and functional studies . MerT works synergistically with periplasmic MerP to bind and translocate Hg(II) ions into the cytoplasm, where mercuric reductase (MerA) reduces them to volatile Hg(0) .

Production and Purification

Recombinant MerT is typically synthesized in E. coli using plasmid vectors (e.g., pET31b or pTZ19R) under T7 or inducible promoters . Key steps include:

  • Cloning: Fusion with ketosteroid isomerase (KSI) to enhance solubility and inclusion body formation .

  • Purification: Affinity chromatography via His tags, yielding >90% purity .

  • Storage: Lyophilized in Tris/PBS buffer with trehalose for stability .

Functional Insights

MerT’s Hg(II) transport mechanism involves:

  1. Binding: Periplasmic MerP transfers Hg(II) to MerT via cysteine thiol groups .

  2. Translocation: Hg(II) traverses the membrane through MerT’s helical channels .

  3. Transfer: Cytoplasmic cysteines (Cys24/Cys25) deliver Hg(II) to MerA for reduction .

Functional Data:

  • Hypersensitivity Mutants: Gly14Arg, Gly15Arg, and Cys24Arg mutations impair transport .

  • Volatilization Rates: MerT-expressing E. coli show 3× higher Hg(0) emission than MerH/MerC strains .

Table 1: Mercury Resistance Phenotypes of MerT Mutants

MutationHgCl₂ MIC (μM)Volatilization Efficiency
Wild-Type MerT81 ± 4100% (baseline)
Cys24Arg<220%
Gly14Arg<220%
MerH (Control)18 ± 430%

Key Observations:

  • Cysteine Dependency: Cytoplasmic cysteines are critical for Hg(II) transport but not for MerT-MerA interactions .

  • Operon Regulation: MerT loss increases Hg(II) threshold for merA induction, reducing resistance .

Applications and Future Directions

Recombinant MerT is pivotal for:

  • Bioremediation: Engineered bacteria expressing MerT/MerP show enhanced Hg(II) sequestration .

  • Biosensors: MerT cysteine mutants could enable selective Hg(II) detection .

  • Structural Studies: NMR and crystallography (e.g., PDB 2M67) to resolve transport dynamics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
merT; Mercuric transport protein; Mercury ion transport protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Streptomyces lividans
Target Names
merT
Target Protein Sequence
MTPPPTQPGDRRGGLLGTLAVVGVALLPIICCAGPVLLASGALAGLGGVLVSPWLLAPAA VLLAGALTWWLRRRRTGNGDACCLPAPRTDQHDRDLLRKQ
Uniprot No.

Target Background

Function
Involved in mercuric transport. Facilitates the transfer of a mercury ion from the MerP protein to the mercuric reductase MerA.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is mercuric transport protein (merT) and what is its primary function?

Mercuric transport protein (merT) is an inner membrane-spanning protein that forms part of the bacterial mercury resistance (mer) system. Its primary function is to transport mercuric ions (Hg²⁺) from the periplasmic space across the inner membrane into the cytoplasm where these ions are subsequently reduced to less toxic metallic mercury (Hg⁰) by mercuric reductase (MR) . MerT is one of several mercury transporters in the mercuric ion (Mer) superfamily that facilitates this membrane potential-dependent transport process . The protein is crucial for bacterial detoxification mechanisms, allowing organisms to survive in mercury-contaminated environments by internalizing and processing toxic mercury compounds .

How does merT contribute to bacterial mercury resistance?

Mercuric ion resistance in bacteria operates through a coordinated system where merT plays a vital transport role. The established model involves merT working in conjunction with other proteins in the mer operon, particularly mercuric reductase. The resistance mechanism follows these steps:

  • Mercuric ions (Hg²⁺) in the periplasmic space are initially captured by periplasmic mercuric ion scavenging protein (MerP)

  • MerT transports these mercury ions across the inner membrane into the cytoplasm

  • Inside the cytoplasm, mercuric reductase reduces Hg²⁺ to less toxic metallic mercury (Hg⁰)

  • The volatile Hg⁰ can then diffuse out of the cell, effectively detoxifying the bacterium

This process requires direct interaction between merT and the N-terminal domain of mercuric reductase, forming a mechanistic basis for mercury resistance in bacteria . The cysteine residues on the cytoplasmic face of merT are essential for maximizing mercuric ion transport efficiency, though interestingly, these residues are not required for the interaction with mercuric reductase .

What is the difference between merT and other mercury transporters?

Mercury transport in bacteria involves several related but distinct proteins from the mercuric ion (Mer) superfamily. Key differences include:

TransporterStructural FeaturesTransport EfficiencySpecificity
MerTInner membrane protein with cytoplasmic cysteine residuesHigh efficiency for Hg²⁺ transportTransports both Hg²⁺ and phenylmercury
MerCMembrane protein with multiple transmembrane domainsHighest potential for Hg²⁺ transport among the transportersBroad-spectrum: transports both Hg²⁺ and phenylmercury
MerEMembrane-spanning proteinLower efficiency than MerCBroad-spectrum mercury transporter
MerFMembrane-spanning proteinLower efficiency than MerCBroad-spectrum mercury transporter
MerPPeriplasmic protein, not membrane-spanningEnhances Hg²⁺ transport when coexpressed with other transportersPrimarily functions as a mercury scavenging protein

Research has demonstrated that while each of these transporters can function in mercury transport, MerC shows the highest potential for Hg²⁺ transport across bacterial membranes compared to MerE, MerF, and MerT . All four transporters (MerC, MerE, MerF, and MerT) are broad-spectrum mercury transporters capable of mediating both Hg²⁺ and phenylmercury transport into cells .

What specific protein interactions are critical for merT function?

The functionality of merT depends on several key protein interactions within the mercury resistance system:

These protein interactions form a functional network that enables efficient mercury detoxification in bacterial systems and provides potential targets for bioengineering applications in mercury bioremediation .

How can transmembrane topology of merT be predicted and verified?

Determining the transmembrane topology of merT involves computational prediction followed by experimental verification:

  • Computational Prediction:

    • TMHMM program analysis of FASTA-formatted sequences can predict transmembrane helices of merT

    • The SOSUI program can be employed to analyze topology, specifically predicting whether N-terminal and C-terminal regions are located in the cytoplasm

    • These computational approaches provide initial models of merT's membrane orientation and structural organization

  • Experimental Verification:

    • Bacterial two-hybrid protein interaction detection systems can verify the cytoplasmic accessibility of merT domains

    • Immunoblot analysis using specific polyclonal antibodies can confirm merT expression and localization in membrane fractions

    • Site-directed mutagenesis of predicted cytoplasmic cysteine residues can validate their functional importance in mercury transport

The integration of these computational and experimental approaches provides researchers with robust methods to characterize merT's transmembrane organization, which is essential for understanding its mercury transport mechanism and engineering recombinant versions for various applications.

What methodological approaches are effective for studying merT transport activity?

Evaluating the transport activity of merT requires specialized methodological approaches:

  • In vivo Transport Assays:

    • Expression of recombinant merT in bacterial systems followed by exposure to mercuric compounds (both Hg²⁺ and phenylmercury)

    • Quantification of intracellular mercury accumulation compared to isogenic control strains

    • Comparative analysis of transport efficiency with and without co-expression of other Mer proteins (particularly MerP)

  • Mutation Analysis:

    • Site-directed mutagenesis of specific residues (particularly cysteine residues) to evaluate their contribution to transport efficiency

    • Functional analysis of truncated or chimeric merT constructs to identify essential domains for mercury transport

  • Expression Systems:

    • For recombinant expression, E. coli XL1-Blue harboring appropriate expression vectors (such as pKF19K) can be grown at 37°C in Luria-Bertani medium supplemented with appropriate antibiotics (e.g., 25 μg/mL kanamycin)

    • Restriction enzymes, DNA ligation kits, and Taq polymerase are used for molecular cloning of merT constructs

  • Transport Quantification:

    • Analytical reagent grade mercury compounds can be used as substrates

    • Transport efficiency can be measured by determining the amount of mercury accumulated within cells expressing different transporter constructs

These methodological approaches provide researchers with reliable tools to investigate the transport properties of merT and compare its activity with other mercury transporters, facilitating the development of optimized systems for mercury bioremediation.

What experimental designs are most appropriate for studying recombinant merT?

When designing experiments to study recombinant merT, researchers should consider multiple experimental design options:

  • Between-Subjects Experimental Design:

    • Each experimental unit (e.g., bacterial culture) is tested under only one condition

    • For example, comparing wild-type merT to mutated versions, each expressed in separate bacterial cultures

    • Essential to ensure that different groups are highly similar except for the variable being tested

    • Appropriate for comparing the effects of different merT variants on mercury transport efficiency

  • Within-Subjects Experimental Design:

    • Each experimental unit experiences all levels of the independent variable

    • For example, testing the same bacterial culture expressing merT under different mercury concentrations or with different mercury compounds

    • Reduces the effects of individual differences between samples but requires consideration of potential carryover effects

  • Mixed-Methods Approach:

    • Combining quantitative measurements of mercury transport with qualitative analysis of protein interactions

    • Can follow a sequential explanatory research design, using qualitative data to explain quantitative findings

    • May include both chart review for quantitative data collection and semi-structured interviews or field notes for qualitative insights

  • Control Conditions:

    • Must include appropriate controls such as bacteria not expressing merT or expressing non-functional merT variants

    • Using random assignment to experimental conditions helps ensure validity of results

    • Consider including positive controls such as known effective mercury transporters (e.g., MerC) for comparative analysis

The selection of experimental design should align with specific research questions about merT function, ensuring that confounding variables are controlled and that results provide meaningful insights into mercury transport mechanisms.

How can researchers overcome challenges in recombinant merT expression?

Researchers face several challenges when working with recombinant merT that can be addressed through methodological approaches:

  • Optimizing Expression Systems:

    • Select appropriate expression vectors and host strains based on the intended application

    • For bacterial expression, E. coli XL1-Blue with vectors like pKF19K provides a reliable system

    • Consider using restriction enzymes, DNA ligation kits, and high-fidelity polymerases for precise construct generation

  • Verifying Protein Expression:

    • Develop specific polyclonal antibodies for immunoblot analysis to confirm expression of recombinant merT in membrane fractions

    • Use proper fractionation techniques to isolate membrane components containing the expressed merT protein

  • Assessing Functional Activity:

    • Compare mercury transport efficiency between bacteria expressing recombinant merT and isogenic control strains

    • Measure both inorganic mercury (Hg²⁺) and organic mercury (e.g., phenylmercury) transport to assess functional breadth

  • Addressing Toxicity Concerns:

    • Implement appropriate safety protocols when handling mercury compounds

    • Use analytical reagent grade mercury for experimental consistency

    • Consider the potential toxicity of recombinant merT expression to host cells and adjust expression levels accordingly

By addressing these challenges methodically, researchers can establish reliable systems for recombinant merT expression and functional analysis, facilitating both basic research and applied bioremediation developments.

How can recombinant merT be utilized in mercury bioremediation systems?

Recombinant merT holds significant potential for environmental bioremediation applications:

  • Enhanced Mercury Uptake Systems:

    • Engineered bacteria expressing optimized merT constructs can serve as biological mercury removal agents

    • The expression of bacterial mercury transporters in plants may improve mercury uptake, potentially shortening the time required to complete environmental purification processes

    • Systems can be designed to express merT alongside other components of the mer operon for complete mercury processing

  • Comparative Efficiency Analysis:

    • Research indicates that while merT is effective, MerC may be the most efficient tool for designing mercurial bioremediation systems because it demonstrates superior mercurial transport capabilities

    • Optimal systems might incorporate multiple transporters (MerC, MerE, MerF, and MerT) to maximize mercury uptake capacity

  • Co-expression Strategies:

    • Combining merT with periplasmic mercury-binding protein MerP can enhance Hg²⁺ transport efficiency

    • The complete mercury detoxification pathway requires co-expression of mercuric reductase to convert internalized Hg²⁺ to volatile Hg⁰

  • Bioengineering Considerations:

    • Bacteria engineered to express individual transporters (MerC, MerE, MerF, or MerT) with or without MerP provide platforms to evaluate transport efficiency for different mercury species

    • Expression systems must be designed to ensure stable membrane integration of recombinant merT

These approaches leverage the natural mercury resistance mechanisms of bacteria for environmental remediation applications, with the potential to develop more efficient and targeted systems through the engineering of recombinant mercury transporters.

What are the current limitations in merT research and future directions?

Current research on merT has several limitations that present opportunities for future investigation:

  • Structural Understanding:

    • Limited detailed structural information about merT and its interactions with mercury ions and other proteins

    • Future research could employ advanced structural biology techniques (X-ray crystallography, cryo-EM) to elucidate the three-dimensional structure of merT in membrane environments

  • Transport Mechanisms:

    • Incomplete understanding of the precise molecular mechanisms of mercury transport by merT

    • Research is needed to clarify the role of cytoplasmic cysteine residues in facilitating mercury transport versus protein interactions

  • Optimization for Bioremediation:

    • Current findings suggest MerC may be more efficient than merT for mercury transport

    • Future research could focus on creating optimized chimeric transporters combining the most efficient features of various Mer proteins

  • Broader Mercury Species Range:

    • Most research has focused on inorganic mercury (Hg²⁺) and phenylmercury

    • Expanded investigation of transport capabilities for other mercury compounds, particularly methylmercury, would enhance application potential

  • Expression in Eukaryotic Systems:

    • Limited research on expressing bacterial merT in eukaryotic cells or organisms

    • Exploration of merT expression in plants or algae could open new avenues for phytoremediation approaches

These research directions would address current knowledge gaps and potentially lead to improved applications of recombinant merT in both basic science and environmental remediation contexts.

What analytical methods are recommended for studying merT-mercury interactions?

Researchers investigating merT-mercury interactions can employ various analytical techniques:

  • Protein-Protein Interaction Analysis:

    • Bacterial two-hybrid protein interaction detection systems have successfully demonstrated the interaction between merT and mercuric reductase

    • Co-immunoprecipitation assays can identify interaction partners of merT in complex cellular environments

  • Mercury Transport Quantification:

    • Analytical reagent grade mercury compounds provide consistent substrates for transport studies

    • Atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS) can quantify cellular mercury accumulation

    • Comparison of mercury uptake between bacteria expressing different merT constructs (wild-type vs. mutants) reveals functional impacts of specific protein modifications

  • Membrane Topology Analysis:

    • Computational predictions using TMHMM and SOSUI programs provide initial models of merT membrane topology

    • Experimental verification through targeted mutagenesis and accessibility assays confirms predicted structures

  • Functional Domain Mapping:

    • Site-directed mutagenesis of specific residues (particularly cytoplasmic cysteines) followed by transport assays identifies critical functional domains

    • Expression of truncated or chimeric constructs helps delineate essential regions for mercury transport versus protein interaction

These analytical approaches provide complementary information about merT structure, function, and interactions, enabling a comprehensive understanding of its role in bacterial mercury resistance and informing the development of recombinant systems for research and application.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.