Recombinant Meriones unguiculatus Beta-1 adrenergic receptor (ADRB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on your purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it based on your preference.
Synonyms
ADRB1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-73
Protein Length
full length protein
Species
Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Target Names
Target Protein Sequence
ISALVSFLPILMHWWRAENDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVY LRVFREAQKQVKK
Uniprot No.

Target Background

Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. It facilitates Ras activation through G(s)-alpha- and cAMP-mediated signaling. In dorsal pons neurons, it plays a role in regulating sleep/wake behaviors.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome.

Q&A

What is the molecular structure of ADRB1 in Meriones unguiculatus and how does it compare to other species?

The Beta-1 adrenergic receptor (ADRB1) in Meriones unguiculatus belongs to the G protein-coupled receptor (GPCR) family, characterized by seven transmembrane domains. Like other adrenergic receptors, it contains a highly conserved alanine residue at position 187 (A187) in the fourth transmembrane domain, which is preserved across vertebrates and invertebrates . This conservation suggests crucial functional significance for this residue.

What expression systems are most effective for producing functional recombinant Meriones unguiculatus ADRB1?

Several expression systems have been employed successfully for recombinant Meriones unguiculatus ADRB1 production, each with distinct advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
Mammalian Cells (HEK293)Native-like post-translational modifications, proper foldingHigher cost, longer production time0.5-2 mg/L
Insect Cells (Sf9)Higher yield than mammalian cells, proper foldingSome differences in glycosylation patterns2-5 mg/L
YeastCost-effective, scalableDifferent glycosylation patterns3-10 mg/L
E. coliHighest yield, cost-effectiveLacks post-translational modifications, refolding often required10-50 mg/L

For functional studies requiring authentic receptor activity, mammalian or insect cell expression systems are recommended despite lower yields, as they provide proper folding and post-translational modifications essential for receptor functionality . When selecting an expression system, researchers should consider the specific requirements of their downstream applications, particularly whether native-like signaling properties are essential.

How can researchers verify the functional integrity of purified recombinant Meriones unguiculatus ADRB1?

Verifying functional integrity requires multiple complementary approaches:

  • Ligand binding assays: Using radiolabeled or fluorescent ligands to determine Kd and Bmax values. Functional recombinant ADRB1 should demonstrate specific binding to beta-adrenergic agonists like isoproterenol with affinity comparable to the native receptor.

  • cAMP accumulation assay: Since ADRB1 mediates catecholamine-induced activation of adenylate cyclase, measuring cAMP production in response to agonists provides direct evidence of functional coupling . Heterozygous expression of wild-type and mutant receptors shows measurable differences in cAMP production when treated with isoproterenol.

  • Calcium mobilization assays: Monitoring intracellular calcium flux using fluorescent indicators upon receptor stimulation.

  • Structural integrity assessment: Circular dichroism spectroscopy to evaluate secondary structure content, and thermal stability assays to determine protein stability.

Researchers should establish appropriate positive controls using well-characterized ADRB1 variants to benchmark functional parameters of their recombinant preparations.

How can researchers effectively study the role of Meriones unguiculatus ADRB1 in sleep regulation?

Investigating ADRB1's role in sleep regulation requires integrating multiple experimental approaches:

  • EEG/EMG recordings: Implement concurrent electroencephalogram and electromyogram recordings to precisely classify sleep states (NREM, REM, wakefulness). Electrode placement should target frontal and parietal cortical regions for optimal signal detection .

  • Fiber photometry: For real-time monitoring of ADRB1+ neuronal activity during sleep-wake transitions, implement calcium imaging using GCaMP6s in freely moving animals. This technique revealed that ADRB1+ neurons in the dorsal pons are active during wakefulness and REM sleep but quiescent during NREM sleep .

  • Optogenetic manipulation: To establish causality between ADRB1+ neuron activity and sleep-wake transitions, utilize Cre-dependent channelrhodopsin expression (e.g., AAV5-DIO-hChR2(H134R)-eYFP) in ADRB1+ neurons. Light stimulation during NREM sleep was shown to elicit immediate transitions to wakefulness, demonstrating the wake-promoting role of these neurons .

  • Sleep deprivation protocols: To assess sleep homeostasis, implement sleep deprivation protocols followed by recovery sleep measurement, focusing on delta power analysis during NREM sleep as an indicator of sleep pressure.

Interestingly, research has shown that ADRB1 A187V mutation leads to decreased total sleep time (~55 minutes less in 24 hours), specifically during the dark phase, with reductions in both NREM (~53 minutes) and REM (~7 minutes) sleep . This makes Meriones unguiculatus ADRB1 particularly valuable for studying natural short sleep phenotypes.

What are the methodological considerations when analyzing signaling differences between wild-type and mutant Meriones unguiculatus ADRB1?

Analyzing signaling differences between wild-type and mutant ADRB1 requires careful experimental design to isolate receptor-specific effects:

  • Heterozygous expression systems: To mimic the human carrier situation, transfect cells with a 1:1 mixture of wild-type and mutant ADRB1. This approach revealed decreased cAMP production in response to isoproterenol compared to wild-type receptor alone .

  • Protein stability assessment: The ADRB1 A187V mutation leads to decreased protein stability. Implement cycloheximide chase assays to measure protein degradation rates and Western blotting to quantify steady-state expression levels. The mutant ADRB1 shows significantly reduced expression levels compared to wild-type .

  • Single-cell imaging techniques: For neuron-autonomous effects, perform ex vivo calcium imaging using acutely isolated dorsal pons explants. This approach helps distinguish between direct cellular effects and secondary circuit-level changes .

  • Dose-response curves: Generate complete dose-response curves with multiple agonist concentrations to accurately capture shifts in EC50 values and maximum response amplitudes between wild-type and mutant receptors.

  • Bias factor calculation: Calculate signaling bias factors to determine whether mutations alter the preferential activation of specific downstream pathways (G protein vs. β-arrestin).

Researchers should be aware that ADRB1 participates in multiple signaling pathways beyond the canonical cAMP pathway, including calcium signaling and MAPK pathways , necessitating comprehensive pathway analysis.

How do post-translational modifications affect the function of recombinant Meriones unguiculatus ADRB1?

Post-translational modifications (PTMs) significantly impact ADRB1 function through several mechanisms:

  • Phosphorylation: Phosphorylation of serine/threonine residues in the C-terminal domain and third intracellular loop by GRKs (G protein-coupled receptor kinases) and PKA leads to desensitization. Different expression systems yield varying phosphorylation patterns, affecting receptor responsiveness to repeated stimulation.

  • Glycosylation: N-linked glycosylation of the N-terminal domain affects receptor trafficking to the plasma membrane and ligand binding properties. E. coli-expressed ADRB1 lacks glycosylation, potentially limiting its utility for certain functional studies.

  • Palmitoylation: Cysteine palmitoylation influences receptor localization within membrane microdomains, affecting coupling efficiency to G proteins.

To systematically assess PTM effects, researchers should:

  • Compare receptor function across different expression systems

  • Use site-directed mutagenesis to eliminate specific modification sites

  • Employ mass spectrometry to map actual modification patterns

  • Assess receptor function before and after enzymatic removal of specific modifications

The choice of expression system directly determines the PTM profile, with mammalian cells providing the most physiologically relevant modifications for Meriones unguiculatus ADRB1 .

What are the comparative advantages of Meriones unguiculatus ADRB1 models over other rodent models in sleep disorder research?

Meriones unguiculatus (Mongolian jird) ADRB1 models offer several distinct advantages for sleep research:

  • Evolutionary positioning: Mongolian jirds represent an evolutionary intermediate between mice and rats, offering unique perspectives on adrenergic receptor evolution and function in rodents.

  • Natural adaptations: As desert-adapted animals, Mongolian jirds have evolved specific sleep patterns and stress responses that may provide novel insights into the relationship between environmental adaptation and adrenergic signaling.

  • Circadian rhythm characteristics: Mongolian jirds exhibit distinct circadian patterns that complement studies in mice and rats, potentially revealing alternative mechanisms of adrenergic influence on circadian regulation.

  • Neuroanatomical considerations: The dorsal pons region, where ADRB1 is highly expressed, shows specific organizational characteristics in Mongolian jirds that may facilitate certain types of sleep circuit investigations.

  • Translational relevance: Some human sleep disorder phenotypes may be more accurately modeled in Mongolian jirds than mice due to specific aspects of their sleep architecture.

Researchers should consider that ADRB1+ neurons in the dorsal pons are primarily glutamatergic (~37%) or GABAergic (~25%) based on vesicular glutamate transporter 2 (Vglut2) or glutamate decarboxylase 1 (Gad1) expression, with very few cholinergic or noradrenergic cells . This neurochemical profile should be considered when selecting animal models for specific sleep disorder investigations.

What are the key challenges in creating stable cell lines expressing recombinant Meriones unguiculatus ADRB1?

Creating stable cell lines expressing recombinant Meriones unguiculatus ADRB1 presents several challenges:

  • Receptor downregulation: Constitutive ADRB1 expression often triggers compensatory downregulation mechanisms. Solution: Implement inducible expression systems such as Tet-On/Off to control expression timing and level.

  • Cytotoxicity: Overexpression of membrane receptors can cause ER stress and cytotoxicity. Solution: Optimize expression levels through promoter selection and clone screening to identify cells with sustainable expression levels.

  • Functional desensitization: Continued exposure to endogenous catecholamines in culture media can desensitize receptors. Solution: Maintain cells in media supplemented with antagonists during selection phases, or use serum with reduced catecholamine content.

  • Receptor heterogeneity: Variable glycosylation and other modifications create receptor heterogeneity. Solution: Implement rigorous quality control through surface binding assays and functional testing of each clone.

  • Genetic drift: Long-term culture can lead to genetic alterations affecting receptor expression. Solution: Maintain frozen stocks of early passages and limit continuous culture duration.

Recent advancements include CRISPR/Cas9-mediated genome editing to create knock-in cell lines where the receptor is expressed under its endogenous promoter, providing more physiological expression patterns .

How can calcium imaging techniques be optimized for studying the activity of neurons expressing recombinant Meriones unguiculatus ADRB1?

Optimizing calcium imaging for ADRB1+ neurons requires attention to several methodological details:

  • Indicator selection: GCaMP6s has been successfully used for recording calcium signals from ADRB1+ neurons in the dorsal pons . For studies requiring higher temporal resolution, consider faster variants like GCaMP7f or GCaMP8f.

  • Delivery method: Cre-dependent AAV encoding fluorescent calcium indicators (e.g., AAV1/Syn-Flex-GCaMP6s-WPRE-SV40) provides cell-type specificity when used with ADRB1-Cre transgenic animals .

  • Fiber placement: For in vivo fiber photometry, precise stereotactic targeting of the dorsal pons is critical. Coordinates should be carefully optimized for Meriones unguiculatus brain anatomy, which differs from standard mouse brain atlases.

  • Signal normalization: To compare neural activity between different mice, normalize GCaMP signal amplitude across active phase (ZT13-16) and sleep phase (ZT1-4) within the same animal rather than directly comparing absolute signals .

  • Concurrent EEG/EMG recording: Simultaneous sleep-state monitoring is essential for correlating calcium signals with behavioral states. Implement dual implantation of fiber optic probes and EEG/EMG electrodes .

For ex vivo studies, acute dorsal pons explants have been successfully used to isolate neuron-autonomous effects from circuit-level changes . This approach is particularly valuable for comparing wild-type and mutant ADRB1 effects on calcium dynamics.

What experimental protocols provide reliable results when studying ligand binding kinetics of recombinant Meriones unguiculatus ADRB1?

Reliable ligand binding studies for recombinant Meriones unguiculatus ADRB1 require careful attention to experimental conditions:

  • Membrane preparation: For consistent results, prepare membranes from cells expressing recombinant ADRB1 using differential centrifugation in buffers containing protease inhibitors. Protein concentration should be standardized (typically 50-100 μg/mL) for comparative studies.

  • Ligand selection: For saturation binding, [³H]-CGP12177 or [¹²⁵I]-cyanopindolol provide high specificity for β-adrenergic receptors. For competition studies, isoproterenol has been effectively used to evaluate functional responses .

  • Assay conditions:

    • Temperature: Maintain consistent temperature (25°C is standard)

    • Buffer composition: 50 mM Tris-HCl, pH 7.4, 5 mM MgCl₂

    • Incubation time: 60-90 minutes to reach equilibrium

    • Non-specific binding: Define with 10 μM propranolol

  • Data analysis: Apply appropriate mathematical models:

    • One-site or two-site binding models depending on receptor homogeneity

    • For heterozygous (WT/mutant) receptors, two-site models may better represent the binding kinetics

  • Validation: Confirm binding parameters with functional assays such as cAMP accumulation. The ADRB1 A187V mutation shows both decreased protein stability and dampened signaling in response to isoproterenol .

A cautionary note: Ligand binding characteristics of Meriones unguiculatus ADRB1 may differ from human or mouse orthologs, necessitating species-specific optimization rather than direct protocol transfer from established models.

How might research on Meriones unguiculatus ADRB1 contribute to understanding the genetic basis of sleep disorders?

The discovery of the ADRB1 A187V mutation in humans with natural short sleep provides a compelling pathway for understanding genetic influences on sleep duration . Future research on Meriones unguiculatus ADRB1 could significantly advance this field through:

  • Comparative genomics approach: Systematic comparison of ADRB1 sequences across species with different natural sleep patterns could reveal additional variants that modify sleep duration. Mongolian jirds offer a valuable comparative model for such studies.

  • Circuit-level investigations: Research has shown that ADRB1+ neurons in the dorsal pons are active during wakefulness and REM sleep, with activation triggering NREM-to-wake transitions . Expanding these studies in Mongolian jirds could reveal species-specific circuit mechanisms that might better translate to human sleep physiology.

  • Pathway integration: ADRB1 participates in multiple signaling pathways including adrenergic signaling in cardiomyocytes, calcium signaling, and amine ligand-binding receptors . Investigating how these pathways interact in sleep regulation could reveal novel therapeutic targets.

  • Pharmacogenetic implications: Different ADRB1 variants may respond differently to medications that target adrenergic signaling. Studying Meriones unguiculatus ADRB1 variants could help predict treatment responses in personalized sleep medicine.

  • Evolutionary sleep adaptations: Comparing the sleep architecture of Mongolian jirds with other rodents in the context of ADRB1 function could provide insights into how adrenergic signaling has evolved to regulate sleep across species.

The combined electrophysiological, calcium imaging, and optogenetic approaches established in ADRB1 research provide a powerful methodological framework for dissecting the complex relationship between genetic variation and sleep phenotypes .

What are the key considerations when designing optogenetic experiments using recombinant ADRB1 in Mongolian jird models?

Designing effective optogenetic experiments with ADRB1 in Mongolian jirds requires careful consideration of several factors:

  • Targeting strategy: Use Cre-dependent optogenetic tools (e.g., AAV5-DIO-hChR2(H134R)-eYFP) in combination with ADRB1-Cre transgenic lines for cell-type specificity . BAC transgenic approaches using large constructs (150kb) containing the entire ADRB1 locus have proven effective for targeting ADRB1+ neurons.

  • Anatomical precision: The dorsal pons contains various nuclei including laterodorsal tegmental nucleus (LDTg), laterodorsal tegmental nucleus ventral (LDTgV), and part of parabrachial nucleus (PB) . Precise stereotactic targeting and post-experimental verification are essential.

  • Stimulation parameters:

    • Frequency: 10 Hz stimulation has been effective for activating ADRB1+ neurons

    • Pulse duration: 10-15 ms pulses

    • Light intensity: Titrate to minimize tissue damage while ensuring activation (typically 5-10 mW)

    • Stimulation pattern: 5-10 seconds of stimulation followed by monitoring periods

  • Behavioral state specificity: The effect of ADRB1+ neuron activation depends on initial sleep state. Stimulation during NREM sleep elicits immediate NREM-to-wake transitions, but similar stimulation cannot trigger REM-to-wake transitions . Design protocols to target specific sleep states.

  • Control conditions: Always include control virus (e.g., AAV5-EF1α-DIO-eYFP) injections in separate animals or contralateral hemispheres .

  • Validation: Confirm optogenetic manipulation efficacy through:

    • Histological verification of opsin expression

    • Electrophysiological recording during light stimulation

    • Calcium imaging to confirm expected neural activity patterns

These approaches have demonstrated that ADRB1+ neurons in dorsal pons are capable of triggering wakefulness from NREM sleep but not from REM sleep, indicating state-dependent effects that should be carefully considered in experimental design .

How do researchers address species-specific differences when adapting ADRB1 experimental protocols from mouse or human studies to Meriones unguiculatus?

Adapting protocols across species requires systematic adjustment of several parameters:

  • Anatomical considerations: Stereotactic coordinates for targeting ADRB1-rich regions like the dorsal pons must be specifically calibrated for Mongolian jird brain anatomy, which differs from mouse brain atlases. Perform pilot surgeries with dye injections to verify targeting accuracy before implementing experimental protocols.

  • Transgenic approaches: When creating ADRB1-Cre BAC transgenic lines in Mongolian jirds, the regulatory elements controlling ADRB1 expression may function differently than in mice. Verify Cre expression patterns through co-staining with probes against endogenous ADRB1 and reporter genes .

  • Pharmacological differences: Dose-response relationships for ADRB1 agonists and antagonists may differ between species. Establish species-specific dose-response curves rather than directly transferring doses from mouse protocols.

  • Behavioral assessment: Sleep architecture and circadian patterns in Mongolian jirds have unique characteristics. Establish species-specific baselines for sleep parameters before interpreting the effects of ADRB1 manipulation.

  • Molecular verification: When studying ADRB1 mutations, confirm that the residue of interest (e.g., A187) is conserved in Mongolian jirds and has similar structural significance. The A187 residue is highly conserved across species, facilitating cross-species comparisons .

Translating ribosome affinity purification (TRAP) of mRNA populations in Cre-expressing cells can help verify the specificity of transgenic approaches, with successful implementations showing 3-4 fold enrichment of endogenous ADRB1 compared to control genes .

What quality control parameters should be monitored when producing recombinant Meriones unguiculatus ADRB1 for research applications?

Rigorous quality control is essential for reliable results with recombinant ADRB1:

  • Expression verification:

    • Western blotting with species-specific antibodies

    • Mass spectrometry confirmation of protein identity

    • Quantification of expression level (typically 0.5-10 mg/L depending on expression system)

  • Functional assessment:

    • Binding affinity for known ligands (Kd should be in the expected nanomolar range)

    • cAMP production in response to isoproterenol stimulation

    • G protein coupling efficiency

  • Structural integrity:

    • Circular dichroism to confirm secondary structure content

    • Thermal stability assays to determine melting temperature

    • Size-exclusion chromatography to assess aggregation state

  • Purity parameters:

    • 90% purity by SDS-PAGE

    • Endotoxin levels <1 EU/mg for in vivo applications

    • Absence of proteolytic degradation products

  • Batch consistency:

    • Lot-to-lot comparison of functional parameters

    • Standardized activity units to normalize across preparations

  • Storage stability:

    • Activity retention after freeze-thaw cycles

    • Long-term stability at -80°C in appropriate buffer conditions

For ADRB1 with specific mutations like A187V, additional quality control should include verification of the mutation by sequencing and comparative analysis with wild-type protein to confirm the expected functional differences, such as decreased protein stability and reduced cAMP signaling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.