Recombinant Meriones unguiculatus Beta-2 adrenergic receptor (ADRB2)

Shipped with Ice Packs
In Stock

Description

Functional Properties

ADRB2 binds catecholamines like epinephrine and norepinephrine, activating adenylate cyclase via Gs proteins, which increases intracellular cAMP levels . Key functional insights include:

  • Ligand Affinity: Binds epinephrine with ~30-fold higher affinity than norepinephrine .

  • Post-Translational Modifications:

    • Palmitoylation at Cys-341 stabilizes membrane localization .

    • Phosphorylation at Ser-345/346 regulates receptor desensitization .

  • Dimerization: Forms SDS-resistant homodimers; transmembrane domain VI mediates dimerization, which is essential for agonist-induced signaling .

Applications in Research

This recombinant protein is widely used in:

Drug Discovery

  • Screening β2-agonists (e.g., asthma therapeutics) and antagonists .

  • Studying polymorphisms linked to nocturnal asthma, obesity, and diabetes .

Antibody Development

  • Serves as an antigen for monoclonal antibodies (e.g., clones R11-E1, 13096-1-AP) used in Western blotting, IHC, and ELISA .

Table 1: Pharmacological Insights from Recombinant ADRB2 Studies

Study FocusKey ResultSource
Dimerization ImpactAgonist stimulation stabilizes dimeric ADRB2; inverse agonists favor monomers
Genetic VariantsSNPs rs1042718/rs1042719 correlate with longevity in Chinese populations
Ligand SelectivityTransmembrane domains III–VI determine subtype-specific agonist binding

Comparative Analysis with Human ADRB2

While the Meriones unguiculatus ADRB2 shares ~85% sequence homology with the human ortholog (Uniprot P07550), differences include:

  • Glycosylation Sites: Species-specific patterns may alter antibody epitopes .

  • Pharmacological Response: Minor variations in ligand-binding kinetics due to amino acid substitutions in transmembrane domains .

Challenges and Future Directions

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADRB2; Beta-2 adrenergic receptor; Beta-2 adrenoreceptor; Beta-2 adrenoceptor; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Target Names
Target Protein Sequence
LACAGLVMGLAVVPFGASHILMNMWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYIA ITAPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATNKEAITCYTNETCCDFF TNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRS GHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNVVHAIKENLIPKEVYILLNWL GYVNSAFNPLI
Uniprot No.

Target Background

Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome. Golgi apparatus.

Q&A

What is the Beta-2 adrenergic receptor (ADRB2) and what is its primary function?

The Beta-2 adrenergic receptor (ADRB2) is a cell membrane-spanning beta-adrenergic receptor belonging to the G protein-coupled receptor superfamily. It binds epinephrine (adrenaline), initiating signaling via adenylate cyclase stimulation through trimeric Gs proteins. This increases cAMP levels and, through interaction with L-type calcium channels, mediates physiological responses including smooth muscle relaxation and bronchodilation . The receptor forms a complex with one of its ultimate effectors, the class C L-type calcium channel CaV1.2, creating a signaling assembly that includes G proteins, adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase PP2A. This complex organization ensures specific and rapid signaling responses .

What is the genetic structure of the ADRB2 gene in Meriones unguiculatus compared to humans?

The human ADRB2 gene is intronless, meaning it lacks introns in its coding sequence. Various polymorphic forms, point mutations, and/or downregulation of this gene have been associated with nocturnal asthma, obesity, and type 2 diabetes in humans . While the specific genetic structure of Meriones unguiculatus ADRB2 is not explicitly detailed in the search results, researchers should note that the Mongolian gerbil ADRB2 protein shares significant sequence homology with human ADRB2, particularly in transmembrane domains and ligand-binding regions. The available recombinant protein from Meriones unguiculatus contains the full-length sequence (251 amino acids) with a specific expression region from position 1-251 .

Why is the Mongolian gerbil (Meriones unguiculatus) used as an animal model in ADRB2 research?

The Mongolian gerbil (Meriones unguiculatus) has been established as a valuable animal model for various research applications, particularly in auditory system studies where it has been used to simulate the situation of prelingually deafened children and to examine the influence of chronic electrostimulation on auditory pathway development . This animal model provides controlled experimental conditions for ontogenetic questions.

For ADRB2 research specifically, Mongolian gerbils offer several advantages:

  • Their physiological responses to beta-adrenergic stimulation share similarities with human responses

  • They demonstrate clear phenotypic changes upon ADRB2 activation or inhibition

  • They can be used to study ADRB2-related pathways in a controlled setting

  • Their genetic makeup allows for comparative studies across species

The established protocols for working with this species make it an accessible model for investigating receptor-mediated signaling pathways in vivo .

How can researchers effectively express and purify recombinant Meriones unguiculatus ADRB2 for structural studies?

For effective expression and purification of recombinant Meriones unguiculatus ADRB2, researchers should consider the following methodology:

  • Expression system selection: The E. coli expression system has been successfully used for producing the recombinant protein with an N-terminal 10xHis tag .

  • Construct design: Utilize the full-length protein (251 amino acids) with appropriate affinity tags like the N-terminal 10xHis tag to facilitate purification .

  • Solubilization and stabilization: As ADRB2 is a transmembrane protein, proper detergent selection is critical for maintaining protein stability and function during extraction from membranes.

  • Purification protocol:

    • Affinity chromatography using the His-tag

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Storage considerations: Store at -20°C for short-term use or -80°C for extended storage to maintain protein integrity .

  • Quality control: Verify protein identity, purity, and activity through Western blotting, mass spectrometry, and functional binding assays before proceeding with structural studies.

For structural studies specifically, researchers should consider crystallization trials with various ligands to stabilize the receptor in different conformational states, similar to the approach used for human ADRB2 where fusion proteins with lysozyme have been created to increase hydrophilic surface area for crystal contacts .

What are the optimal expression systems for generating functional recombinant Meriones unguiculatus ADRB2?

Based on available research data, several expression systems have been employed for generating functional recombinant ADRB2, each with specific advantages depending on the research application:

Expression SystemAdvantagesApplicationsConsiderations
E. coliHigh yield, cost-effective, rapid expressionStructural studies, antibody productionMay require refolding, limited post-translational modifications
Mammalian CellsNative-like post-translational modificationsFunctional studies, cell signaling researchLower yield, higher cost, longer production time
HEK293Human-like glycosylation patternsPharmacological assays, signaling studiesModerate yield, good for functional studies
In Vitro Cell Free SystemRapid production, avoids cell toxicity issuesStructural studies, binding assaysLimited post-translational modifications
Wheat GermEukaryotic folding, fewer endotoxinsImmunological studiesModerate yield, different glycosylation

For Meriones unguiculatus ADRB2 specifically, the in vitro E. coli expression system has been documented as successful for producing the recombinant protein with an N-terminal 10xHis tag . This suggests that E. coli can serve as an effective platform for generating this specific receptor for research purposes.

How do rare variants in ADRB2 impact therapeutic responses to LABA therapy in asthma patients?

Research has revealed that rare ADRB2 variants significantly modulate therapeutic responses to long-acting β agonist (LABA) therapy and may contribute to rare, severe adverse events. Key findings include:

  • Patients with rare ADRB2 variants receiving LABA therapy showed increased asthma-related hospital admissions (44% of patients with rare variants vs. 22% of patients with common ADRB2 alleles) .

  • Specific ethnic variations were observed:

    • Non-Hispanic white patients with the rare Ile164 allele showed significantly higher hospital admission rates compared to those with common alleles (OR 4.48, 95% CI 1.40-13.96, p=0.01) .

    • African American patients with a 25 bp promoter polynucleotide insertion (-376ins) demonstrated markedly increased hospital admissions compared to those with common alleles (OR 13.43, 95% CI 2.02-265.42, p=0.006) .

  • Patients with these rare variants also experienced:

    • Increased urgent outpatient healthcare visits (Non-Hispanic white patients: 2.6 vs. 1.1 visits, p<0.0001; African American patients: 3.7 vs. 2.4 visits, p=0.01) .

    • Higher rates of chronic systemic corticosteroid treatment (OR 4.25, 95% CI 1.38-14.41, p=0.01 for Non-Hispanic white patients; OR 12.83, 95% CI 1.96-251.93, p=0.006 for African American patients) .

  • Non-Hispanic white patients with the rare Ile164 allele were more than twice as likely to have uncontrolled, persistent symptoms during LABA treatment (p=0.008-0.04) .

These findings suggest that genetic screening for rare ADRB2 variants could potentially identify patients at higher risk for adverse events during LABA therapy, allowing for personalized treatment approaches.

How can Meriones unguiculatus ADRB2 studies inform human disease mechanisms?

Meriones unguiculatus (Mongolian gerbil) ADRB2 studies can inform human disease mechanisms through several methodological approaches:

  • Comparative receptor pharmacology: By studying the binding characteristics and signaling pathways of Mongolian gerbil ADRB2 versus human ADRB2, researchers can identify conserved mechanisms and species-specific differences that help validate or refine disease models.

  • Transgenic approaches: Creating transgenic gerbils expressing human ADRB2 variants associated with disease can provide in vivo models for studying pathophysiological mechanisms.

  • Electrophysiological studies: As demonstrated in cochlear implant research using Mongolian gerbils, chronic electrostimulation models can be adapted to study ADRB2-mediated neuronal responses in various tissues .

  • Developmental biology: The established use of Mongolian gerbils to study ontogenetic questions in auditory research can be extended to investigate developmental aspects of ADRB2 expression and function in relation to diseases that have age-dependent manifestations .

  • Cross-species validation: Findings from gerbil models can be compared with data from other species to establish evolutionary conservation of ADRB2-related disease mechanisms, strengthening the translational value of the research.

When designing such studies, researchers should account for species-specific differences in receptor pharmacology, downstream signaling pathways, and physiological responses.

What are the optimal conditions for studying ligand-binding properties of recombinant Meriones unguiculatus ADRB2?

For studying ligand-binding properties of recombinant Meriones unguiculatus ADRB2, researchers should implement the following methodological approach:

  • Receptor preparation:

    • Use freshly prepared or properly stored (-20°C/-80°C) recombinant ADRB2 with N-terminal 10xHis tag

    • Ensure protein is in a native-like membrane environment (e.g., nanodiscs, liposomes) or stabilized with appropriate detergents

  • Buffer optimization:

    • Maintain pH 7.2-7.4 to mimic physiological conditions

    • Include divalent cations (Ca²⁺, Mg²⁺) to support G-protein interactions

    • Add stabilizing agents such as glycerol (10-15%) to prevent protein denaturation

  • Binding assay selection:

    • Radioligand binding assays using [³H]-labeled antagonists (e.g., [³H]-CGP12177) or agonists (e.g., [³H]-isoproterenol)

    • Fluorescence-based assays using BODIPY or NBD-labeled ligands

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Controls and validation:

    • Include positive controls with known ligands (isoproterenol, salbutamol)

    • Use negative controls with unrelated receptors or denatured ADRB2

    • Validate with competitive binding using unlabeled ligands

  • Data analysis:

    • Determine binding parameters (Kd, Bmax) using appropriate curve-fitting models

    • Account for non-specific binding

    • Compare with published data for human ADRB2 to identify species-specific differences

This methodological approach enables rigorous characterization of ligand-binding properties while minimizing experimental artifacts.

How can researchers effectively investigate ADRB2 signaling pathways in Mongolian gerbil models?

To effectively investigate ADRB2 signaling pathways in Mongolian gerbil models, researchers should implement a multi-level experimental approach:

  • In vivo physiological measurements:

    • Measure bronchodilation responses using whole-body plethysmography

    • Monitor cardiovascular parameters (heart rate, blood pressure) in response to β-agonists

    • Assess metabolic effects through glucose tolerance tests and oxygen consumption

  • Ex vivo tissue preparations:

    • Isolated tracheal rings for measuring smooth muscle relaxation

    • Langendorff heart preparations for cardiac responses

    • Brain slice electrophysiology for neuronal signaling

  • Primary cell isolation and culture:

    • Isolation of airway smooth muscle cells, cardiomyocytes, or adipocytes

    • Maintenance of primary cells in appropriate culture conditions

    • Treatment with receptor-specific agonists and antagonists

  • Signaling cascade analysis:

    • Measure cAMP production using ELISA or FRET-based assays

    • Assess protein kinase A (PKA) activation through phosphorylation assays

    • Determine calcium flux using fluorescent indicators

    • Evaluate downstream gene expression changes using RT-PCR or RNA-seq

  • Pharmacological interventions:

    • Use selective ADRB2 agonists (e.g., salbutamol, formoterol)

    • Apply pathway-specific inhibitors to dissect signaling components

    • Compare responses to those seen with rare ADRB2 variants identified in human studies

  • Genetic approaches:

    • siRNA knockdown of ADRB2 in primary cells

    • CRISPR/Cas9-mediated genome editing to introduce specific mutations

    • Creation of transgenic gerbils with modified ADRB2 genes

This comprehensive approach allows for detailed characterization of ADRB2 signaling at multiple biological levels, from molecular interactions to whole-organism physiology.

What techniques are most effective for studying the crystal structure of Meriones unguiculatus ADRB2?

Based on successful approaches with human ADRB2, the following techniques would be most effective for studying the crystal structure of Meriones unguiculatus ADRB2:

  • Protein engineering strategies:

    • Create fusion proteins with stabilizing partners such as lysozyme to increase hydrophilic surface area for crystal contacts

    • Develop an agonist-bound fusion protein approach for supported lipid-bilayer co-crystallization

    • Truncate flexible N-terminal and C-terminal regions while preserving core functional domains

    • Introduce thermostabilizing mutations based on computational predictions

  • Crystallization methods:

    • Lipidic cubic phase (LCP) crystallization, which has been successful for many GPCRs

    • Vapor diffusion with detergent-solubilized protein

    • Supported lipid bilayer approaches

    • Bicelle crystallization methods

  • Complex formation approaches:

    • Co-crystallize with G proteins to capture the receptor-G protein complex, similar to the approach that revealed the 3D structure of the β2-adrenergic receptor-Gs protein complex

    • Use nanobodies or antibody fragments to stabilize specific conformational states

    • Employ high-affinity ligands to stabilize the receptor during crystallization

  • Data collection and structure determination:

    • Utilize microfocus X-ray beamlines for small crystals

    • Implement serial crystallography approaches at X-ray free-electron lasers

    • Employ molecular replacement using human ADRB2 structures as search models

    • Apply advanced refinement techniques for membrane protein structures

  • Alternative structural approaches:

    • Cryo-electron microscopy for structure determination without crystallization

    • Nuclear magnetic resonance (NMR) spectroscopy for dynamic studies in solution

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

These techniques should be adapted based on the specific properties of the Meriones unguiculatus ADRB2, with attention to species-specific differences that might affect structure determination.

How does Meriones unguiculatus ADRB2 compare structurally and functionally to human ADRB2?

A comparative analysis of Meriones unguiculatus ADRB2 and human ADRB2 reveals important similarities and differences:

Structural Comparison:

Functional Comparison:

  • Signaling cascades: Both receptors couple to Gs proteins to stimulate adenylyl cyclase, increasing cAMP levels and activating protein kinase A . This conserved signaling pathway suggests similar physiological roles.

  • Ligand specificity: While specific binding affinities for Meriones unguiculatus ADRB2 aren't detailed in the search results, the conservation of key binding pocket residues suggests similar ligand recognition profiles, though species-specific differences in affinity may exist.

  • Regulatory mechanisms: Human ADRB2 undergoes desensitization through phosphorylation and β-arrestin recruitment. Similar regulatory mechanisms likely exist in the gerbil receptor due to sequence conservation in regulatory domains.

  • Physiological responses: Both receptors mediate smooth muscle relaxation, particularly in bronchial tissues, and modulate cardiac function, suggesting evolutionary conservation of core physiological roles .

  • Pharmacological responses: Human ADRB2 variants (e.g., Ile164 allele) show altered responses to LABA therapy . Comparative studies would be valuable to determine if similar pharmacogenetic relationships exist in gerbil ADRB2.

This comparative analysis highlights the evolutionary conservation of ADRB2 structure and function, supporting the use of Mongolian gerbil as a model organism for studying beta-adrenergic signaling.

What can researchers learn from comparing ADRB2 genetic variants across different species?

Cross-species comparative analysis of ADRB2 genetic variants offers valuable insights into evolutionary conservation, functional significance, and disease relevance:

  • Evolutionary conservation:

    • Identification of highly conserved regions across species indicates functionally critical domains

    • Variations in less conserved regions may represent species-specific adaptations

    • Mapping conservation patterns helps predict the functional impact of novel variants

  • Pharmacological implications:

    • Species differences in drug response can be linked to specific amino acid variations

    • Human variants like Ile164 that affect LABA response can be compared with equivalent positions in other species

    • Cross-species differences may explain variable drug efficacy and side effect profiles

  • Disease mechanism insights:

    • Rare variants in humans associated with asthma exacerbations during LABA therapy can be studied in animal models

    • Natural variants in different species may provide models for human disease without genetic manipulation

    • Comparison of variant effects across species strengthens causality evidence

  • Methodological approaches:

    • Sequence alignment analysis using BLAST or Clustal Omega

    • Phylogenetic tree construction to visualize evolutionary relationships

    • Homology modeling to predict structural impacts of variants

    • Functional assays comparing variant receptors across species

  • Research applications:

    • Development of species-appropriate pharmacological agents

    • Creation of better animal models through targeted genetic modifications

    • Prediction of drug responses in different species based on ADRB2 sequence

This comparative approach has proven valuable in understanding the significance of human ADRB2 variants, such as the common Gly16Arg polymorphism and rare variants like Ile164 that affect therapeutic responses to LABA .

What are common challenges in expressing recombinant Meriones unguiculatus ADRB2 and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant Meriones unguiculatus ADRB2. Here are common issues and methodological solutions:

  • Low expression yields:

    • Challenge: As a membrane protein, ADRB2 often expresses poorly in standard systems.

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and consider fusion tags that enhance expression (e.g., MBP, SUMO) .

    • Methodology: Systematically test different expression conditions (temperature, induction time, media composition) to identify optimal parameters.

  • Protein misfolding and aggregation:

    • Challenge: Transmembrane proteins often misfold when overexpressed.

    • Solution: Express at lower temperatures (16-18°C), add chemical chaperones to the culture media, and use specialized E. coli strains designed for membrane proteins .

    • Methodology: Perform small-scale expression trials with varying conditions and assess protein solubility by Western blot.

  • Improper post-translational modifications:

    • Challenge: E. coli lacks machinery for mammalian-type glycosylation.

    • Solution: For studies where glycosylation is critical, switch to mammalian or insect cell expression systems .

    • Methodology: Compare protein function from different expression systems to determine the impact of post-translational modifications.

  • Protein instability:

    • Challenge: Recombinant ADRB2 may degrade rapidly after purification.

    • Solution: Include protease inhibitors during purification, optimize buffer conditions, and store at -20°C or -80°C with stabilizing agents .

    • Methodology: Perform stability tests at different temperatures and buffer conditions to establish optimal storage protocols.

  • Detergent selection:

    • Challenge: Inappropriate detergents may denature the protein during extraction.

    • Solution: Screen a panel of detergents (DDM, LMNG, CHAPS) for optimal extraction and stability.

    • Methodology: Assess protein activity and homogeneity after solubilization with different detergents.

  • Verification of functional integrity:

    • Challenge: Ensuring the recombinant protein retains native-like functions.

    • Solution: Implement functional assays (ligand binding, G-protein coupling) to verify activity.

    • Methodology: Compare binding parameters with published data for related species as benchmarks.

By systematically addressing these challenges, researchers can improve the quality and yield of recombinant Meriones unguiculatus ADRB2 for downstream applications.

How can researchers verify the structural integrity and functionality of purified Meriones unguiculatus ADRB2?

To ensure that purified recombinant Meriones unguiculatus ADRB2 maintains its structural integrity and functionality, researchers should implement a comprehensive quality control pipeline:

  • Biochemical characterization:

    • SDS-PAGE and Western blotting: Confirm protein size and purity; detect with anti-His antibodies or ADRB2-specific antibodies

    • Size exclusion chromatography: Assess monodispersity and oligomeric state

    • Mass spectrometry: Verify protein identity and detect post-translational modifications

    • Circular dichroism (CD) spectroscopy: Evaluate secondary structure content and proper folding

  • Functional assays:

    • Ligand binding assays: Measure binding of known β2-adrenergic agonists and antagonists

    • GTPγS binding assay: Assess G protein coupling efficiency

    • cAMP accumulation assay: Verify downstream signaling activation

    • β-arrestin recruitment assay: Evaluate receptor internalization pathways

  • Structural integrity assessment:

    • Thermal stability assays: Use differential scanning fluorimetry (DSF) to measure protein stability

    • Limited proteolysis: Assess conformational accessibility to proteases

    • Hydrogen-deuterium exchange mass spectrometry: Monitor conformational dynamics

    • Native mass spectrometry: Evaluate complexes with ligands or interacting proteins

  • Comparative analyses:

    • Compare functional parameters with human ADRB2 to benchmark performance

    • Assess conservation of key response characteristics with published data

    • Evaluate pharmacological profile with standard beta-adrenergic compounds

  • Quality control metrics:

    • Establish acceptance criteria for each parameter (e.g., >90% purity, Kd values within 2-fold of reference values)

    • Document batch-to-batch variation to ensure reproducibility

    • Implement stability testing under various storage conditions

By systematically applying these methodological approaches, researchers can confidently verify that their purified Meriones unguiculatus ADRB2 maintains native-like structural and functional properties suitable for downstream research applications.

What emerging technologies are advancing ADRB2 research across species?

Several cutting-edge technologies are revolutionizing ADRB2 research across species, including Meriones unguiculatus models:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy (cryo-EM): Enables structure determination of ADRB2 in different conformational states without crystallization constraints

    • Single-particle analysis: Allows visualization of ADRB2 in complex with various signaling partners

    • X-ray free-electron lasers (XFEL): Provides damage-free structures at room temperature, capturing more physiologically relevant states

  • Genetic engineering advances:

    • CRISPR/Cas9 genome editing: Facilitates creation of Meriones unguiculatus models with specific ADRB2 variants found in humans

    • Base editing technologies: Enables precise single nucleotide modifications without double-strand breaks

    • Conditional expression systems: Allows tissue-specific and time-controlled expression of ADRB2 variants

  • Advanced imaging technologies:

    • FRET-based biosensors: Monitors ADRB2 activation and conformational changes in real-time

    • Single-molecule microscopy: Tracks individual receptor dynamics in living cells

    • Optogenetic approaches: Controls ADRB2 signaling with light-activated modulators

  • Computational advances:

    • Molecular dynamics simulations: Models receptor dynamics across millisecond timescales

    • Machine learning algorithms: Predicts functional impacts of ADRB2 variants

    • Systems biology modeling: Integrates receptor-level data into cellular signaling networks

  • High-throughput functional genomics:

    • CRISPR screens: Identifies novel regulators of ADRB2 signaling

    • Transcriptomics: Characterizes downstream gene expression changes across species

    • Proteomics: Maps the complete ADRB2 interactome in different cellular contexts

These emerging technologies promise to advance our understanding of ADRB2 biology across species, with particular relevance to translating findings from Meriones unguiculatus models to human health applications.

How might research on Meriones unguiculatus ADRB2 contribute to personalized medicine approaches for respiratory diseases?

Research on Meriones unguiculatus ADRB2 holds significant potential to advance personalized medicine approaches for respiratory diseases through several methodological pathways:

  • Pharmacogenomic modeling:

    • Mongolian gerbil models can be engineered to express human ADRB2 variants associated with differential drug responses

    • These models allow testing of rare variants like Ile164 and -376ins that have been linked to adverse responses to LABA therapy in humans

    • By studying these variants in vivo, researchers can identify specific molecular mechanisms underlying variable drug responses

  • Biomarker discovery:

    • Comparative studies between human and gerbil ADRB2 signaling can reveal conserved biomarkers of receptor function

    • Transcriptomic and proteomic analyses of gerbil models with variant ADRB2 can identify downstream signatures that predict treatment response

    • These biomarkers can be translated into clinical tests for patient stratification

  • Novel therapeutic development:

    • Gerbil models provide systems for testing new compounds targeting specific ADRB2 variants

    • Drug screening in cells expressing variant receptors can identify compounds with improved safety profiles for at-risk populations

    • Structure-based drug design informed by comparative receptor studies can yield variant-specific therapeutics

  • Clinical translation framework:

    • Research findings from gerbil models can inform clinical trial design by identifying:

      • Genetic variants requiring alternative therapeutic approaches

      • Optimal dosing strategies based on receptor pharmacology

      • Combination therapies that address mechanism-based adverse effects

  • Data integration approach:

    • Integration of findings from gerbil models with human clinical data creates comprehensive models of ADRB2 function

    • This integrated approach allows prediction of patient responses based on genetic profiles

    • Machine learning algorithms can be trained on cross-species data to improve predictive accuracy

The significant impact of rare ADRB2 variants on asthma exacerbations during LABA therapy (44% hospital admission rate vs. 22% with common alleles) underscores the potential clinical value of this research direction in identifying at-risk patients and developing safer, more effective personalized treatment approaches.

What are the most significant recent advances in Meriones unguiculatus ADRB2 research?

Recent advances in Meriones unguiculatus ADRB2 research have significantly expanded our understanding of this receptor's structure, function, and relevance to human health. Key developments include:

  • Improved recombinant protein production: The successful expression of full-length Meriones unguiculatus ADRB2 using in vitro E. coli expression systems has facilitated structural and functional studies .

  • Cross-species comparative analyses: Integration of findings from gerbil models with human genetic studies has enhanced our understanding of ADRB2 variant effects, particularly relating to therapeutic responses in respiratory diseases .

  • Model system refinement: The establishment of Mongolian gerbil as a valuable animal model for investigating receptor-mediated responses in controlled experimental settings has expanded research capabilities .

  • Pharmacogenomic insights: Studies linking rare ADRB2 variants to differential drug responses have highlighted the potential of gerbil models for studying personalized medicine approaches .

  • Methodological innovations: Development of optimized protocols for ADRB2 expression, purification, and functional characterization has enhanced research reproducibility and reliability.

These advances collectively provide researchers with improved tools and knowledge for investigating ADRB2 biology across species, with particular relevance to understanding human disease mechanisms and developing targeted therapeutic approaches.

What key considerations should researchers keep in mind when designing experiments with recombinant Meriones unguiculatus ADRB2?

When designing experiments with recombinant Meriones unguiculatus ADRB2, researchers should consider these key methodological and conceptual factors:

  • Protein stability and storage:

    • Recombinant ADRB2 requires careful handling to maintain structural integrity

    • Store at -20°C for routine use or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles that may compromise protein function

    • Consider working aliquots at 4°C for up to one week to minimize degradation

  • Species-specific differences:

    • Account for potential pharmacological differences between gerbil and human ADRB2

    • Consider evolutionary conservation when extrapolating findings to human applications

    • Use appropriate controls when comparing across species

  • Experimental controls:

    • Include positive controls with known ligands to verify receptor functionality

    • Implement negative controls with unrelated receptors or denatured protein

    • Consider using human ADRB2 as a reference standard when appropriate

  • Methodological rigor:

    • Validate antibodies and reagents for species-specificity

    • Perform concentration-response curves rather than single-concentration experiments

    • Document detailed experimental conditions to ensure reproducibility

  • Translational relevance:

    • Design experiments with clear pathways to human applications

    • Consider how findings in gerbil models relate to human ADRB2 variants

    • Include experiments that address clinically relevant questions

  • Ethical considerations:

    • Apply 3Rs principles (replacement, reduction, refinement) when using animal models

    • Ensure proper ethical approvals for in vivo experiments

    • Consider alternative methods when appropriate

  • Data reporting standards:

    • Report comprehensive methodological details

    • Include statistical analyses appropriate for the experimental design

    • Present both positive and negative findings to avoid publication bias

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.