Recombinant Meriones unguiculatus Beta-3 adrenergic receptor (ADRB3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ADRB3; Beta-3 adrenergic receptor; Beta-3 adrenoreceptor; Beta-3 adrenoceptor; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Target Names
Target Protein Sequence
RVGADAEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRRLL RRELGRFPPEESPRSPSRSPSPVAGGTGEAPDGVPSCGRRPARLLPLREHRALRTLGLIM GIFSLCWLPFFLANVLRALAGPSIVPNGVFIALNWLGYANSAFNPLI
Uniprot No.

Target Background

Function
Beta-adrenergic receptors mediate catecholamine-induced activation of adenylate cyclase via G proteins. The beta-3 subtype plays a crucial role in regulating lipolysis and thermogenesis.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

Intermediate Research Questions

  • What experimental approaches are recommended for studying recombinant Meriones unguiculatus ADRB3 signaling?

    When investigating ADRB3 signaling, multiple experimental approaches can be employed:

    1. cAMP accumulation assays: As ADRB3 primarily signals through Gs proteins to activate adenylyl cyclase, measuring cAMP production is a direct functional readout. Researchers have used this approach to study mouse and human ADRB3 responses to agonists like BRL37344 and CL316243 .

    2. Phosphorylation studies: Monitor downstream signaling by measuring phosphorylation of targets like p38 MAPK, HSL (hormone-sensitive lipase), or CREB using phospho-specific antibodies .

    3. Respirometry: For functional studies related to thermogenesis, measuring oxygen consumption in cells expressing ADRB3 before and after agonist stimulation can reveal functional activation .

    4. Lipolysis assays: Measuring free fatty acid or glycerol release from adipocytes following ADRB3 activation provides a functional readout relevant to the receptor's physiological role .

    Experimental design considerations:

    MeasurementTechniqueTimeframeConsiderations
    Receptor bindingRadioligand binding1-2 hoursADRB3 has low affinity for many radioligands used for other β-ARs
    cAMP productionELISA, FRET-based sensorsMinutes to hoursRapid response; can detect acute signaling
    PhosphorylationWestern blot, phospho-ELISAs5-30 minutesDifferent targets show different kinetics
    LipolysisFFA/glycerol assays1-4 hoursPhysiologically relevant functional readout

    When designing these experiments, species-specific differences in ligand potency and efficacy must be considered .

  • How can researchers validate the functionality of recombinant Meriones unguiculatus ADRB3 in their experimental systems?

    To ensure that recombinant ADRB3 is properly folded and functional, researchers should implement multiple validation approaches:

    1. Agonist-induced signaling: Treat cells expressing the recombinant receptor with beta-3 selective agonists (e.g., CL316243 or BRL37344) and measure cAMP production or phosphorylation of downstream targets. Based on studies with mouse ADRB3, expected EC50 values for CL316243 would be in the nanomolar range for rodent receptors .

    2. Selective antagonist blockade: Verify that ADRB3-selective antagonists like SR 59230A block agonist-induced effects, while controlling for potential alpha-1 adrenergic receptor interactions that have been documented with this compound .

    3. Positive and negative controls: Include human or mouse ADRB3 as comparative controls, as well as cells not expressing ADRB3, to establish specificity of responses.

    4. Western blotting: Confirm protein expression using validated antibodies, though cross-reactivity testing may be necessary as most commercial antibodies target human ADRB3 .

    For functional validation, researchers can compare the pharmacological profile to known profiles of rodent ADRB3 receptors. In mouse models, ADRB3 shows high sensitivity to lipolytic compounds like BRL37344 and partial agonistic effects from beta-1 and beta-2 antagonists such as CGP12177A, oxprenolol, and pindolol .

  • What are the common challenges when working with recombinant ADRB3 from rodent species and how can they be addressed?

    Researchers face several challenges when working with rodent ADRB3, including Meriones unguiculatus ADRB3:

    1. Receptor desensitization: ADRB3 undergoes downregulation upon prolonged agonist exposure. Studies show that β3-AR mRNA decreases significantly within 2 hours of agonist treatment, with protein levels dramatically downregulated after 12 hours . To minimize this effect:

      • Use short incubation times for acute signaling studies

      • For chronic studies, implement intermittent dosing protocols

      • Consider inhibiting EPAC signaling, which has been implicated in ADRB3 desensitization mechanisms

    2. Species-specific pharmacology: Significant pharmacological differences exist between rodent and human ADRB3:

      CompoundEffect on Rodent ADRB3Effect on Human ADRB3
      CL316243High potency (pEC50 8.7)Lower potency (pEC50 4.3)
      BRL37344Higher affinityLower affinity

      Researchers should determine dose-response relationships specifically for Meriones unguiculatus ADRB3 rather than assuming identical pharmacology to mouse or human receptors .

    3. Membrane localization: As a GPCR, proper membrane targeting is essential. Verify cellular localization using fluorescently-tagged constructs or immunocytochemistry with non-permeabilized versus permeabilized conditions to confirm surface expression.

  • How do different agonists and antagonists interact with rodent ADRB3 compared to human ADRB3?

    Pharmacological differences between rodent and human ADRB3 are significant and must be considered when designing experiments:

    CompoundClassificationEffect on Rodent ADRB3Effect on Human ADRB3Research Application
    BRL37344AgonistHigh potency, high efficacyLower potency than in rodents; controversial pharmacologyWidely used in both human and mouse settings
    CL316243AgonistHigh potency, good selectivity (pEC50 8.7 for mouse)Low potency but good selectivity (pEC50 4.3); >128-fold higher selectivity for β3 vs β1Used in studies on human detrusor muscle relaxation
    CGP12177Partial agonistPartial agonistic effectSimilar partial agonist effect; positive inotropic effect in human atrial myocytesUseful for distinguishing between receptor states
    L-748,337AntagonistLower affinityHigher affinityUseful for comparing species differences
    SR59230AAntagonistBlocks ADRB3 but also has α1-adrenergic effectsSimilar dual activityCaution needed when interpreting results

    When studying Meriones unguiculatus ADRB3, these pharmacological differences highlight the importance of:

    1. Establishing dose-response relationships specifically for the species being studied

    2. Using multiple, structurally diverse ligands to confirm receptor-specific effects

    3. Including appropriate controls to distinguish between ADRB3 and other adrenergic receptor subtypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.