Recombinant Meriones unguiculatus Monocarboxylate transporter 2 (SLC16A7)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via E. coli expression systems, optimized for high yield and stability . Post-purification steps involve Tris-based buffers with 50% glycerol to maintain solubility and functionality during storage at -20°C or -80°C .

Cancer Metabolism Studies

  • MCT2 overexpression is linked to tumor progression in prostate and breast cancers, driven by epigenetic deregulation (e.g., promoter demethylation) .

  • Recombinant MCT2 enables in vitro studies on lactate shuttling in cancer microenvironments, particularly in models exploring metabolic crosstalk between adipocytes and carcinoma cells .

Neurological Research

  • MCT2 supports oligodendrocyte function by importing lactate and ketone bodies for myelin maintenance. Knockdown studies in mice highlight its role in preventing axonal degeneration .

  • The gerbil variant may aid comparative studies of species-specific transporter efficiency .

Antibody Development

  • Anti-MCT2 antibodies (e.g., Boster Bio A05214) utilize recombinant proteins as immunogens for Western blot validation in human and rat models .

Future Directions

  • Targeted Therapies: MCT2 inhibition is being explored to disrupt cancer metabolic pathways .

  • Neurodegenerative Diseases: Recombinant MCT2 could model therapeutic strategies for multiple sclerosis, given its role in oligodendrocyte metabolism .

  • Structural Biology: Cryo-EM studies using recombinant MCT2 may resolve substrate-binding dynamics and guide drug design.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributors for precise delivery timelines.
Note: All our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC16A7; MCT2; Monocarboxylate transporter 2; MCT 2; Solute carrier family 16 member 7; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-71
Protein Length
full length protein
Species
Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Target Names
SLC16A7
Target Protein Sequence
AFVDMFSRPCGGLIANTRLVRPRIQYFFSLAIVFTGVCHLLCPLAESYTALVVYAIFFGY GFGSVSSILFE
Uniprot No.

Target Background

Function
Proton-coupled monocarboxylate transporter. Facilitates rapid transport across the plasma membrane of various monocarboxylates, including lactate, pyruvate, branched-chain oxo acids derived from leucine, valine, and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate, and acetate. Functions as a high-affinity pyruvate transporter.
Protein Families
Major facilitator superfamily, Monocarboxylate porter (TC 2.A.1.13) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.