Recombinant Meriones unguiculatus Type-1 angiotensin II receptor (AGTR1)

Shipped with Ice Packs
In Stock

Description

Western Blot Validation

  • Positive Detection: Validated in Hela, Raji, and MCF-7 whole-cell lysates .

  • Antibody Specificity: Rabbit polyclonal antibody (DF4910) cross-reacts with human, mouse, and rat AGTR1, with predicted reactivity in pig, bovine, and horse .

Calcium Mobilization Assay

  • Recombinant AGTR1 expressed in HEK293 cells demonstrates dose-dependent intracellular calcium mobilization upon angiotensin II stimulation (EC₅₀ = 1.23 nM) .

  • IP-One accumulation assays confirm Gαq-coupled signaling (EC₅₀ = 3.53 nM) .

Cardiovascular Pathophysiology

  • Hypertension Models: AGTR1 knockout mice (Agtr1a–/–) show prolonged lifespan, reduced oxidative stress, and attenuated cardiac injury, highlighting its role in aging and cardiovascular health .

  • Renal Fibrosis: Bone marrow-derived macrophages lacking AGTR1 exacerbate renal fibrosis in obstructive nephropathy models, linking receptor activity to macrophage function .

Therapeutic Targeting

  • Antibody Studies: Anti-AGTR1 monoclonal antibodies induce endothelial glycocalyx degradation, reversible by losartan (AT1 antagonist), suggesting therapeutic potential in vascular dysfunction .

  • Autoantibody Detection: Anti-AGTR1 autoantibodies correlate with severe COVID-19 outcomes, emphasizing its role in endothelial injury .

Comparative Analysis of AGTR1 Expression Systems

Expression HostAdvantagesLimitations
E. coliCost-effective, high yieldLack of post-translational modifications
HEK293 CellsNative-like glycosylation, functional assaysLower yield, higher cost
Baculovirus (Insect Cells)Eukaryotic processing, scalabilityTime-intensive, complex optimization

Future Directions

  • Structural Biology: Cryo-EM studies to resolve full-length AGTR1 in nanodiscs .

  • Drug Screening: High-throughput assays using HEK293/AT1 stable cell lines to identify novel antagonists .

  • Species-Specific Studies: Comparative analyses of AGTR1 across rodents to refine translational models .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1; GkAT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Target Names
Target Protein Sequence
MALNSSADDGIKRIQDDCPKAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK TVASVFLLNLALADLCFLLTLPVWAVYTAMEYRWPFGNHLCKIASAGISFNLYASVFLLT CLSIDRYLAIVHPMKSRLRRTMLVAKVTCVVIWLLAGLASLPAVIHRNVYFIENTNSTVC AFHYESQNSTLPVGLGLTKNILGFMFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFR IIMAIVLFFFFSWIPHQIFTFLDVLIQLGVIRDCKIADVVDTAMPITICIAYFNNCLNPL FYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNMNSSAKKPASCFEVE
Uniprot No.

Target Background

Function

This product is a recombinant Meriones unguiculatus Type-1 angiotensin II receptor (AGTR1). It functions as a receptor for angiotensin II, mediating its effects through G protein association, which subsequently activates a phosphatidylinositol-calcium second messenger system.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Meriones unguiculatus AGTR1 and how does it compare to human AGTR1?

Meriones unguiculatus AGTR1 is a 359-amino acid transmembrane protein with similar structure to its human ortholog. The full amino acid sequence of Mongolian gerbil AGTR1 includes key functional domains that characterize this receptor across species . Like the human variant, it functions as a G-protein coupled receptor that specifically binds angiotensin II and mediates its effects on cardiovascular regulation.

The protein has several alternative names, including Angiotensin II type-1 receptor, AT1, and GkAT1 . Comparative analysis shows the basic structure follows the conserved pattern of seven transmembrane domains characteristic of this receptor family, though species-specific variations exist in certain regions that may affect ligand binding properties.

Why are Mongolian gerbils considered valuable model organisms for AGTR1 research?

Mongolian gerbils (Meriones unguiculatus) offer several advantages as model organisms for AGTR1 research, particularly in cardiovascular studies. These animals are primarily distributed in Inner Mongolia of China, Mongolia, and Russia, and have been widely adopted for laboratory research . Their value stems from several key characteristics:

  • Their serum cholesterol levels are susceptible to dietary modifications without inducing atherosclerosis, making them excellent models for studying cholesterol metabolism and its relationship to AGTR1 function .

  • Approximately 10% of gerbils become obese on standard diets, exhibiting decreased glucose tolerance and diabetic changes in various organs, which allows researchers to study AGTR1's role in metabolic disorders .

  • Gerbils serve as established models for hearing research, cerebrovascular diseases, and Helicobacter pylori infections, providing versatility for studying AGTR1 across multiple pathological conditions .

These characteristics enable researchers to investigate AGTR1's role in various physiological and pathophysiological processes that are relevant to human disease.

What are the recommended protocols for working with recombinant Meriones unguiculatus AGTR1 in laboratory settings?

When working with recombinant Meriones unguiculatus AGTR1, researchers should consider the following methodological guidelines:

Storage and Handling:

  • Store at -20°C for regular use, or at -80°C for extended storage

  • Avoid repeated freeze-thaw cycles as this degrades protein quality

  • Working aliquots can be maintained at 4°C for up to one week

Buffer Composition:
The optimal buffer for recombinant AGTR1 is a Tris-based buffer with 50% glycerol, specifically optimized for this protein . This composition helps maintain protein stability and activity during storage and experimental procedures.

Expression Systems:
While the search results don't specify the exact expression systems for gerbil AGTR1, similar approaches to those used for human AGTR1 can be adapted. For functional studies, expression in mammalian cell lines is recommended to ensure proper post-translational modifications and membrane insertion.

How can genetic manipulation techniques be applied to study AGTR1 function in Mongolian gerbils?

Recent advances have established CRISPR/Cas9-based genome editing platforms for Mongolian gerbils, providing effective tools for studying AGTR1 function through genetic manipulation . The methodology includes:

  • Zygote microinjection timing: Optimal results occur when zygote microinjection is conducted 22 hours after human chorionic gonadotropin (hCG) injection .

  • Preparation of pseudopregnant recipients: These are induced by injecting equine chorionic gonadotropin (eCG) and hCG at a 70-hour interval, followed by caging with ligated male gerbils .

  • Gene targeting efficiency: While not specific to AGTR1, studies of other genes have shown knockout efficiencies ranging from 30.9% to 55%, demonstrating the viability of this approach for AGTR1 modification .

  • Off-target assessment: Thorough assessment for off-target effects should be conducted, though existing studies report no detectable off-target mutations in generated knockout gerbils .

This genetic manipulation platform provides researchers with tools to create AGTR1 knockout or modified gerbils for investigating receptor function in vivo.

What are the key AGTR1 polymorphisms identified in research models and their functional implications?

While specific polymorphisms in Mongolian gerbil AGTR1 are not detailed in the search results, research on human AGTR1 polymorphisms provides important comparative insights:

rs5186 (A1166C) Variant:
This polymorphism, located in the 3′ UTR of the AGTR1 gene, is the most extensively studied variant . Though not within a coding region or splice site, it may affect mRNA stability and transcription, or be in linkage disequilibrium with regulatory polymorphisms .

Population Frequency Distribution:
The frequency of the rs5186 variant shows significant ethnic variation:

  • European populations: 0.19-0.31

  • Asian populations: 0.03-0.11

  • African populations: 0.05-0.08

In a Thai population study, the AGTR1 rs5186 genotype frequencies were:

  • Wild-type AA: 85%

  • Heterozygous mutant AC: 13.6%

  • Homozygous mutant CC: 1.4%

These findings suggest that genetic background significantly influences AGTR1 polymorphism distribution, which must be considered when developing and interpreting gerbil models.

How do AGTR1 polymorphisms influence susceptibility to cardiovascular diseases in research models?

AGTR1 polymorphisms significantly impact cardiovascular disease susceptibility, though research shows considerable heterogeneity in findings. The renin-angiotensin system, in which AGTR1 plays a crucial role, is central to blood pressure regulation .

Key findings include:

These findings highlight the complex relationship between AGTR1 genetics and cardiovascular phenotypes, suggesting that multiple genetic and environmental factors influence how AGTR1 polymorphisms manifest in disease models.

What are the signaling pathways mediated by AGTR1 and their implications for disease modeling?

AGTR1 mediates several critical signaling pathways with important implications for disease modeling. The receptor is involved in:

  • PI3K/Akt Pathway Activation: This pathway regulates cell survival, proliferation, and metabolism, making it relevant for studying cardiovascular and metabolic disorders .

  • Ras/MAPK Signaling: AGTR1 activates this pathway, which influences cell growth, differentiation, and various cellular responses to environmental stimuli .

  • Fluid and Electrolyte Regulation: AGTR1 signaling impacts ion channels and transporters that regulate fluid balance, with implications for hypertension and kidney disease models .

Through these pathways, AGTR1 influences various physiological processes including blood pressure regulation, fluid and electrolyte balance, and cell growth and differentiation through its interaction with angiotensin II . These mechanisms make Mongolian gerbil AGTR1 models valuable for investigating the molecular basis of cardiovascular disorders, renal diseases, and metabolic conditions.

How can recombinant Meriones unguiculatus AGTR1 be utilized in drug discovery and validation research?

Recombinant Meriones unguiculatus AGTR1 offers several applications in drug discovery and validation:

Screening Platforms:
The availability of recombinant AGTR1 protein enables development of high-throughput screening assays for compounds that modulate receptor function. These may include radioligand binding assays, functional cell-based assays, and biophysical interaction studies.

Therapeutic Target Validation:
Given AGTR1's role in cardiovascular health and its association with conditions like hypertension, myocardial infarction, and heart failure , gerbil AGTR1 models can validate potential therapeutic targets in the renin-angiotensin system.

Cancer Research Applications:
The variable expression of AGTR1 in various cancers suggests its potential as a therapeutic target for tumors . Recombinant AGTR1 can be used to screen compounds targeting this receptor in cancer contexts.

Antibody Development:
Researchers can generate and validate specific antibodies against gerbil AGTR1 for use in various applications including Western blotting, immunohistochemistry, and immunofluorescence , facilitating more detailed investigation of receptor expression and localization.

How does the genetic profile of Meriones unguiculatus AGTR1 compare with other model organisms?

Comparative genomic analysis of AGTR1 across species provides valuable insights for researchers using Mongolian gerbil models. While the search results don't provide direct comparisons of AGTR1 across species, they do provide relevant genomic information:

The mitochondrial genome analysis of Mongolian gerbils shows it has 63.0% A+T content, which is similar to the Murinae average (62.4 ± 0.8%) and between that of Mus and Rattus species . The A-skew and C-skew values of M. unguiculatus were 0.035 and -0.28, respectively, which are close to those of Cricetinae (0.057 ± 0.05 and -0.31 ± 0.05) .

While this data does not directly address AGTR1, it suggests that Mongolian gerbils have genomic characteristics that position them between mice and rats, with similarities to other rodent families like Cricetinae. This genomic positioning may have implications for AGTR1 structure and function across rodent models.

Researchers should consider these genomic relationships when selecting appropriate animal models for studying AGTR1 in specific disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.