Recombinant Mesembryanthemum crystallinum V-type proton ATPase 16 kDa proteolipid subunit (VMAC1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Physiology

VMAC1 is integral to stress adaptation in the halophyte M. crystallinum:

  • Salt Stress Response: NaCl treatment upregulates VMAC1 mRNA levels, enhancing V-ATPase activity for vacuolar Na⁺/H⁺ antiport .

  • CAM Induction: During Crassulacean Acid Metabolism (CAM) transition, VMAC1 supports nocturnal malate storage by acidifying vacuoles .

  • ABA Signaling: Abscisic acid mimics salt-induced VMAC1 expression, implicating hormonal regulation in stress tolerance .

Recombinant Production and Applications

Commercially available recombinant VMAC1 is engineered for research use:

ParameterSpecification
Expression SystemE. coli with N-terminal 10xHis tag
Purity>90% (SDS-PAGE verified)
Storage-20°C (short-term) or -80°C (long-term); avoid repeated freeze-thaw cycles
Product CodeCSB-CF002389MRC

Research Applications:

  • Mechanistic studies of V-ATPase assembly and proton translocation .

  • Salt tolerance engineering in crops .

  • Protein interaction assays (e.g., yeast two-hybrid) .

Genomic and Transcriptional Regulation

The VMAC1 gene resides in a 377.97 Mb genome (N50 scaffold: 40.45 Mb) with no recent whole-genome duplication events . Key transcriptional insights:

  • Stress-Induced Expression: Salinity triggers a >2-fold mRNA increase within 24 hrs, distinct from osmotic stress responses .

  • Tissue Specificity: Preferential leaf expression aligns with its role in mesophyll vacuolar function .

Comparative and Evolutionary Insights

  • Gene Family: VMAC1 belongs to a conserved proteolipid family with homologs in Beta vulgaris and other halophytes .

  • Evolutionary Dynamics: M. crystallinum retains ancestral chromosomal rearrangements but lacks recent polyploidy events seen in related species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
VMAC1; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Mesembryanthemum crystallinum (Common ice plant) (Cryophytum crystallinum)
Target Names
VMAC1
Target Protein Sequence
MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Uniprot No.

Target Background

Function
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is VMAC1 and what is its role in plant cells?

VMAC1 is the 16 kDa proteolipid subunit of the V-type proton ATPase (V-ATPase) complex in Mesembryanthemum crystallinum (common ice plant). The V-ATPase serves as the dominant proton pump in plant cells, playing critical roles in cytosolic pH homeostasis and energizing transport processes across endomembranes . VMAC1 specifically functions as part of the membrane-integral V₀ subsector of the V-ATPase complex, which is responsible for proton transport. The protein contains four transmembrane helices with a conserved glutamate residue that is essential for proton binding and transport .

How does recombinant VMAC1 differ from native VMAC1?

Recombinant VMAC1 produced in expression systems such as E. coli typically includes additional elements not present in the native protein, such as affinity tags (e.g., His-tag) that facilitate purification. The recombinant protein available for research purposes is expressed in E. coli and includes an N-terminal His tag . While the core functional sequence remains intact, researchers should consider potential effects of these modifications on protein folding, stability, and activity compared to the native form. Additionally, recombinant VMAC1 lacks post-translational modifications that might be present in the native plant protein, which could affect certain functional studies.

What are the optimal conditions for recombinant VMAC1 expression in E. coli?

For optimal expression of recombinant VMAC1 in E. coli, researchers should consider the following methodological approach:

  • Vector selection: Use expression vectors with strong, inducible promoters (e.g., T7) and appropriate fusion tags (His-tag is commonly used for VMAC1) .

  • Host strain optimization: E. coli BL21(DE3) or Rosetta strains are recommended for membrane proteins like VMAC1, as they provide the translational machinery needed for efficient expression.

  • Culture conditions:

    • Grow cultures at 37°C until reaching mid-log phase (OD₆₀₀ of 0.6-0.8)

    • Induce with 0.5-1.0 mM IPTG

    • Reduce temperature to 18-25°C post-induction

    • Continue expression for 16-20 hours

  • Buffer optimization: Include glycerol (5-10%) and mild detergents in lysis buffers to enhance membrane protein solubilization.

These parameters should be optimized for each specific experimental setup, as expression efficiency can vary based on construct design and laboratory conditions.

What purification strategies yield the highest purity and functional integrity of VMAC1?

For high-purity, functionally intact VMAC1, a multi-step purification protocol is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged VMAC1 .

  • Intermediate purification: Ion exchange chromatography (IEX) to separate based on charge differences.

  • Polishing step: Size exclusion chromatography (SEC) to achieve >90% purity and remove aggregates.

  • Buffer considerations:

    • Maintain Tris/PBS-based buffers (pH 8.0)

    • Include 6% trehalose as a stabilizing agent

    • Add appropriate detergents at concentrations above their critical micelle concentration (CMC)

  • Quality control: Verify purity using SDS-PAGE (should exceed 90%) and assess functionality through ATPase activity assays.

For long-term storage, adding 5-50% glycerol (with 50% being optimal) and aliquoting before storage at -20°C/-80°C significantly improves stability and prevents repeated freeze-thaw cycles .

What are the most effective methods for analyzing VMAC1's membrane topology and interactions?

Multiple complementary techniques should be employed to comprehensively analyze VMAC1's membrane topology and interactions:

  • Cysteine scanning mutagenesis: Systematically replace residues with cysteine to map membrane-spanning regions and accessibility.

  • Crosslinking studies: Use bifunctional crosslinkers of varying lengths to identify neighboring subunits and interacting domains within the V-ATPase complex.

  • Förster resonance energy transfer (FRET): Label specific residues with fluorophore pairs to measure distances between domains and monitor conformational changes during proton transport.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map solvent-accessible regions and protein dynamics in different functional states.

  • Cryo-electron microscopy: Visualize the entire V-ATPase complex with VMAC1 in its native environment, providing insights into larger structural arrangements.

The structural analysis should focus particularly on the four transmembrane helices and the conserved glutamate residue in the fourth helix that serves as the protein binding site, as these features are crucial for VMAC1's function in proton transport .

How can researchers effectively study the proton binding site in VMAC1?

To study the critical proton binding site in VMAC1, researchers should implement this methodological approach:

  • Site-directed mutagenesis: Modify the conserved glutamate residue in the fourth transmembrane helix to assess its role in proton binding and transport .

  • pH-dependent spectroscopy: Monitor structural changes using circular dichroism (CD) or fluorescence spectroscopy across pH gradients.

  • Isothermal titration calorimetry (ITC): Measure binding thermodynamics of protons under varying buffer conditions.

  • Electrophysiology: Reconstitute VMAC1 in lipid bilayers to directly measure proton conductance.

  • Molecular dynamics simulations: Model proton binding and movement through the protein structure.

MutationExpected Effect on FunctionExperimental Verification Method
E→QLoss of proton binding capacityATPase activity assay
E→DAltered pKa and transport kineticspH-dependent conductance measurements
E→AComplete loss of functionProton transport assay in reconstituted vesicles

These studies should focus on understanding how the unique structural arrangement of VMAC1's transmembrane domains facilitates proton binding and translocation during the catalytic cycle of the V-ATPase complex.

What assays effectively measure VMAC1's proton transport activity?

To quantitatively assess VMAC1's proton transport activity, the following assays are recommended:

  • Fluorescence-based assays:

    • ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching

    • SNARF-1 ratiometric pH measurements

    • These methods allow real-time monitoring of proton transport in reconstituted proteoliposomes

  • Reconstitution systems:

    • Purified recombinant VMAC1 should be reconstituted with other V-ATPase subunits in liposomes

    • For isolated function studies, VMAC1 can be reconstituted alone to assess passive proton conductance

  • Patch-clamp electrophysiology:

    • Direct measurement of proton currents through VMAC1-containing membranes

    • Can distinguish between different functional states and inhibitor effects

  • ATP hydrolysis coupling:

    • Measure ATP consumption in parallel with proton transport to assess coupling efficiency

    • Use colorimetric phosphate release assays (malachite green) or coupled enzyme assays

When designing these experiments, researchers should establish appropriate controls using inactive VMAC1 mutants (particularly mutations in the conserved glutamate residue) to distinguish specific activity from background measurements.

How does VMAC1 interact with other V-ATPase subunits to facilitate proton transport?

VMAC1 functions within the larger V-ATPase complex through specific interactions with other subunits. To characterize these interactions:

  • Co-immunoprecipitation studies:

    • Use anti-His antibodies to pull down His-tagged VMAC1 along with interacting partners

    • Mass spectrometry analysis of the precipitated complex identifies direct and indirect interactions

  • Cross-linking coupled with mass spectrometry:

    • Apply chemical cross-linkers of varied spacer lengths to identify proximity relationships

    • MS/MS analysis identifies cross-linked peptides, revealing interaction interfaces

  • Yeast two-hybrid or bacterial two-hybrid screening:

    • Systematically test interactions between VMAC1 and other V-ATPase subunits

    • Map specific domains involved in these interactions

VMAC1 primarily interacts with other components of the V₀ sector, including VHA-c" subunits to form the proteolipid ring that enables proton translocation . The proteolipid ring interacts with the VHA-a subunit, which forms semi-channels for proton loading and unloading . Additionally, the cytosolic loop of proteolipids serves as a binding site for the VHA-d subunit, connecting the V₀ and V₁ sectors .

How can VMAC1 be used to study salt stress responses in halophytic plants?

Mesembryanthemum crystallinum (ice plant) is a facultative halophyte that employs V-ATPase activity as a key mechanism for salt stress adaptation. To leverage VMAC1 in salt stress research:

  • Comparative expression analysis:

    • Quantify VMAC1 expression levels under varying salt concentrations using qRT-PCR

    • Perform Western blot analysis with anti-VMAC1 antibodies to track protein abundance

    • Compare expression patterns between the ice plant and glycophytes

  • Transgenic approaches:

    • Overexpress VMAC1 in model plants (Arabidopsis, tobacco) to assess enhanced salt tolerance

    • Create knockout/knockdown lines to evaluate functional significance

    • Use fluorescently tagged VMAC1 to track subcellular localization changes during salt stress

  • Proteomic interaction network analysis:

    • Identify salt-stress-specific interaction partners using differential proteomics

    • Map post-translational modifications induced by salt stress

  • Electrophysiological measurements:

    • Compare proton transport activity in vesicles isolated from salt-stressed versus control plants

    • Assess how salt-induced changes in membrane lipid composition affect VMAC1 function

These approaches will help elucidate how VMAC1's function in proton transport contributes to the unique salt tolerance mechanisms in halophytic plants.

What strategies can effectively target VMAC1 for improving crop resilience to environmental stressors?

To harness VMAC1's potential for enhancing crop resilience, researchers should consider these strategic approaches:

  • Gene editing approaches:

    • CRISPR/Cas9 modification of native VMAC1 orthologs in crops to enhance activity

    • Target regulatory elements controlling VMAC1 expression

    • Engineer VMAC1 variants with improved stability under stress conditions

  • Heterologous expression systems:

    • Introduce ice plant VMAC1 into glycophytic crops under stress-inducible promoters

    • Co-express with other V-ATPase subunits to ensure complex assembly

  • Structure-guided protein engineering:

    • Modify proton binding sites to optimize catalytic efficiency

    • Enhance membrane integration stability through targeted mutations

  • Screening protocol development:

    • Design high-throughput screening systems for identifying VMAC1 variants with enhanced stress tolerance

    • Use yeast complementation assays as a first-pass functional screen

ApproachPotential AdvantagesTechnical ChallengesEvaluation Methods
Native gene editingMaintains regulatory contextSpecies-specific optimization requiredGrowth assays under stress conditions
Heterologous expressionIntroduces novel functionalityPotential energy burden on plantVacuolar pH measurements
Protein engineeringTargeted functional enhancementComplex structure-function relationshipsIn vitro transport assays
Promoter modificationStress-specific activationUnpredictable effects on other genesTranscriptome analysis

When implementing these strategies, researchers should consider the energetic costs of enhanced V-ATPase activity and potential tradeoffs with other physiological processes.

What are common challenges in recombinant VMAC1 expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant VMAC1. Here are methodological solutions to these issues:

  • Protein misfolding and aggregation:

    • Lower expression temperature to 16-18°C after induction

    • Co-express with molecular chaperones (GroEL/GroES, DnaK)

    • Add mild detergents (0.1% DDM or LDAO) during cell lysis

    • Include 6% trehalose in buffers to enhance stability

  • Low expression yields:

    • Optimize codon usage for E. coli expression

    • Test multiple E. coli strains (BL21, C41/C43 for membrane proteins)

    • Try fusion partners (MBP, SUMO) to enhance solubility

    • Scale up culture volumes while maintaining optimal aeration

  • Proteolytic degradation:

    • Add protease inhibitor cocktails during all purification steps

    • Reduce purification time and maintain samples at 4°C

    • Consider adding EDTA (1 mM) to inhibit metalloproteases

  • Functional inactivity:

    • Reconstitute protein in lipid compositions mimicking plant membranes

    • Ensure proper pH during purification to maintain proton-binding site integrity

    • Verify protein orientation in reconstituted systems

For storage, aliquot purified VMAC1 and store at -20°C/-80°C with 50% glycerol to prevent repeated freeze-thaw cycles . When reconstituting after lyophilization, use deionized sterile water to achieve a protein concentration of 0.1-1.0 mg/mL .

How can researchers validate that recombinant VMAC1 maintains native structural conformation?

Ensuring recombinant VMAC1 maintains its native structure is crucial for meaningful functional studies. Researchers should implement these validation approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content

    • Thermal shift assays to assess protein stability

    • Dynamic light scattering to evaluate monodispersity

    • Tryptophan fluorescence to monitor tertiary structure

  • Functional validation:

    • Reconstitution with other V-ATPase subunits to measure ATP-dependent proton transport

    • Confirm binding to known interaction partners (e.g., VHA-d subunit)

    • Test pH-dependent conformational changes using intrinsic fluorescence

  • Structural comparison methods:

    • Limited proteolysis patterns compared to native protein

    • Hydrogen-deuterium exchange mass spectrometry to map solvent accessibility

    • Epitope mapping with conformation-specific antibodies

A comprehensive validation protocol should include at least one method from each category above. Additionally, researchers should verify that recombinant VMAC1 correctly assembles into oligomeric structures by using native PAGE or analytical ultracentrifugation, as the native V₀ subsector contains a ring of ten proteolipid molecules .

What emerging technologies could advance our understanding of VMAC1's role in plant adaptation?

Several cutting-edge technologies hold promise for revealing new insights into VMAC1 function:

  • Single-molecule biophysics:

    • Optical tweezers to study force generation during conformational changes

    • Single-molecule FRET to track real-time structural dynamics

    • These approaches can reveal transient states during the proton transport cycle

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize VMAC1 distribution in plant cells under stress

    • Correlative light and electron microscopy (CLEM) to connect function with ultrastructure

    • Cryo-electron tomography of membrane fragments containing V-ATPase complexes

  • Integrative structural biology:

    • AlphaFold2 and other AI-based structure prediction tools to model complete V-ATPase assemblies

    • Molecular dynamics simulations to model membrane integration and proton movement

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to position VMAC1 in adaptive networks

    • Quantitative trait locus (QTL) mapping for natural VMAC1 variants associated with stress tolerance

These technologies will help answer fundamental questions about how VMAC1's molecular function translates to whole-plant physiology and environmental adaptation in Mesembryanthemum crystallinum and potentially in other plant species.

How might VMAC1 research contribute to synthetic biology applications in environmental stress mitigation?

VMAC1 research opens several promising avenues for synthetic biology applications:

  • Designer proton transport systems:

    • Engineer synthetic V-ATPase complexes with modified VMAC1 for enhanced efficiency

    • Create simplified proton pumps by combining minimal functional units

    • Design pH-responsive genetic circuits regulated by proton gradient sensing

  • Biomimetic materials development:

    • Create artificial vesicles with incorporated VMAC1 for controlled proton transport

    • Develop biomimetic membranes for energy-capturing devices inspired by V-ATPase function

    • Engineer drought-responsive materials that change properties based on proton gradients

  • Cell-free protein production systems:

    • Utilize VMAC1-containing vesicles to energize cell-free synthetic biology platforms

    • Maintain pH homeostasis in artificial cell systems

  • Agricultural biotechnology:

    • Develop stress-responsive transcriptional regulatory systems controlled by V-ATPase activity

    • Create biosensors for monitoring plant stress responses in field conditions

    • Engineer rhizobacteria with modified proton pumps to enhance nutrient availability

The convergence of VMAC1 structural studies, functional characterization, and synthetic biology approaches could yield novel technologies that not only advance fundamental understanding but also contribute to addressing agricultural challenges in a changing climate.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.