Recombinant Mesentericin Y105 secretion protein mesE (mesE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
mesE; Mesentericin Y105 secretion protein MesE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Leuconostoc mesenteroides
Target Names
mesE
Target Protein Sequence
MFDPKYLESGEFYQRRYRNFPTLIIVPIFLLVVFIVLFSLFAKREIVVKASGEIIPAKVL SDIQSTSNNAIDSNQLAENKMVKKGDTLVTFTSGNEKISSQLLTQQINNLNNRIQSLDTY KHSIIDGRSEFGGTDQFGYDNLFNGYMAQVDTLTSEFNQQNSDKQTADQQANHQIDVLKQ GQSKNNQQLANYQAILTSINSNTKPTNNPYQSIYDNYAAQLKSAQTTDDKEQVKQTALSS VQQQIDQLQTTSSSYDSQIAGITKSGPLSQSSTLDKIADLKQQQLASAQKEINDQQQSLD ELKAKQSSANEDYQDTVIKAPESGILHLTSDKATIKYFPKGTTVTQIYPMLNKRTKLSVE YYVPTSNSVGLKRGQNIRFVANQNVTKPLILTGTIKTISSAPIIIKEESFYKCIASINVN VREHEQIKYGLAGKVTTTKGTKTWFNYYKDILLGNTN
Uniprot No.

Target Background

Function

Involved in the secretion of mesentericin Y105.

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is mesentericin Y105 secretion protein MesE and what is its biological function?

Mesentericin Y105 secretion protein MesE is a 457-amino acid membrane fusion protein that forms an essential component of the dedicated bacteriocin transport system in Leuconostoc mesenteroides. It functions in cooperation with the ATP-binding cassette transporter MesD to secrete bacteriocins, particularly mesentericin Y105 and B105 . The primary biological function of MesE is to facilitate bacteriocin secretion independently of the general sec-dependent secretion pathway . Structurally, MesE belongs to a class of accessory proteins that assist ABC transporters in moving substrates across bacterial membranes.

Research has demonstrated that MesE plays a critical role in the translocation process by forming a channel-like structure that spans the cell membrane and connects the inner membrane ABC transporter to the outer environment. Deletion or mutation studies have confirmed that without functional MesE, bacteriocin secretion is significantly impaired, even when the ATP-binding transporter MesD remains intact .

How does the MesDE transport system process bacteriocin secretion?

The MesDE transport system processes bacteriocin secretion through a coordinated mechanism involving recognition, cleavage, and translocation of pre-bacteriocins. The process begins with the synthesis of pre-bacteriocins containing a leader peptide with a characteristic N-terminal extension ending with a Gly-Gly motif upstream of the cleavage site .

The transport mechanism follows these steps:

  • The pre-bacteriocin is recognized by the MesD-MesE complex, particularly through interactions between the leader peptide and the N-terminal domain of MesD

  • The N-terminal extension of MesD (MesDp) contains a protease domain that cleaves the leader peptide at the Gly-Gly motif

  • MesD uses ATP hydrolysis to energize the transport process

  • MesE forms a channel or pore-like structure that facilitates the movement of the mature bacteriocin across the membrane

  • The mature bacteriocin is released into the extracellular environment

This mechanism allows for the efficient export of mesentericin Y105 and B105, despite their having distinct leader peptide sequences .

How do mutations in the leader peptide affect mesentericin Y105 secretion and processing by MesE?

Site-specific mutagenesis studies have revealed that certain amino acids in the leader peptide of pre-mesentericin Y105 are critical for optimal secretion and processing by the MesDE transport system. The hydrophobic conserved amino acids and the C-terminal GG doublet in the leader peptide play particularly important roles in these processes .

When the hydrophobic conserved amino acids in the leader peptide are substituted, several negative effects occur:

  • Reduced recognition by the MesDE transport complex

  • Decreased efficiency of transport across the membrane

  • Impaired cleavage of the leader peptide by the protease domain of MesD

Similarly, mutations in the C-terminal GG doublet dramatically reduce processing efficiency. In vitro studies with the MesDp protease domain show that alterations to the GG motif result in either miscleavage or no cleavage of the pre-bacteriocin .

The following table summarizes the effects of various mutations on mesentericin Y105 processing and secretion:

Mutation TypeLocation in Leader PeptideEffect on ProcessingEffect on Secretion
Hydrophobic to polarConserved hydrophobic residuesSignificant reductionSevere impairment
GG to GAC-terminal doubletMiscleavageModerate reduction
GG to AGC-terminal doubletMiscleavageModerate reduction
GG to AAC-terminal doubletNo cleavageComplete inhibition

These findings highlight the importance of specific amino acid sequences in the leader peptide for the proper functioning of the MesE-mediated secretion system .

What are the differences in MesE proteins between different Leuconostoc strains and how do they affect bacteriocin secretion?

Comparative analysis of MesE proteins from different Leuconostoc strains, particularly L. mesenteroides Y105 and L. mesenteroides FR52, has revealed significant sequence differences despite both strains producing mesentericin Y105 and B105 in equal amounts . These differences are primarily concentrated in the mesD and mesE genes that encode the dedicated transport system.

Despite these sequence variations, both transport systems are capable of secreting either bacteriocin effectively. This functional conservation despite structural differences suggests that:

  • The critical domains for bacteriocin recognition and transport are preserved between strains

  • The system has evolved to maintain functional redundancy despite sequence drift

  • The bacteriocin secretion machinery has flexibility in substrate recognition

Experimental complementation studies have demonstrated that when the mesDE genes from one strain are introduced into non-producing mutants of another strain, bacteriocin production is restored . This cross-complementation confirms that despite sequence differences, the fundamental mechanism of transport and the critical interaction domains remain functional.

The sequence variations primarily affect non-critical regions of the proteins, suggesting that evolutionary pressure has maintained the functional domains while allowing other regions to diversify. This finding has important implications for understanding the evolution of bacteriocin transport systems and for engineering these systems for biotechnological applications.

How can the MesE protein be recombinantly expressed and purified for structural and functional studies?

For robust recombinant expression and purification of MesE protein, the following optimized protocol has been developed based on research findings:

  • Construct Design:

    • Clone the full-length mesE gene (1-457 amino acids) into an expression vector with an N-terminal His-tag

    • Include a suitable promoter such as T7 or tac for inducible expression

    • Ensure the presence of appropriate restriction sites for cloning verification

  • Expression System:

    • Transform the construct into E. coli expression strains (BL21(DE3) or derivatives)

    • Culture in LB medium supplemented with appropriate antibiotics

    • Induce protein expression with IPTG (0.1-1.0 mM) when cultures reach OD600 of 0.6-0.8

    • Continue expression at lower temperature (16-25°C) for 16-20 hours to enhance proper folding

  • Protein Extraction:

    • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

    • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole)

    • Disrupt cells using sonication or high-pressure homogenization

    • Clarify lysate by centrifugation (15,000 × g, 30 min, 4°C)

  • Purification:

    • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Wash with increasing concentrations of imidazole (20-50 mM)

    • Elute purified protein with high imidazole (250-500 mM)

    • Perform size-exclusion chromatography for higher purity

  • Storage:

    • Dialyze against storage buffer (Tris/PBS-based buffer, pH 8.0)

    • Add 6% trehalose as a stabilizing agent

    • Add glycerol to a final concentration of 50%

    • Store in aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles

For functional studies, the purified MesE protein can be reconstituted into liposomes or nanodiscs to mimic its native membrane environment. This approach allows for detailed investigation of its role in bacteriocin transport and its interactions with MesD and pre-bacteriocins.

What experimental approaches can determine the interaction between MesE and MesD during bacteriocin secretion?

To investigate the molecular interactions between MesE and MesD during bacteriocin secretion, several complementary experimental approaches can be employed:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of MesE and MesD (His-tag, FLAG-tag)

    • Perform pull-down assays to identify protein-protein interactions

    • Analyze precipitated complexes by Western blotting or mass spectrometry

    • This technique can confirm direct interaction between the two proteins in vitro

  • Bacterial Two-Hybrid System:

    • Create fusion constructs of MesE and MesD with DNA-binding and activation domains

    • Co-transform into reporter bacterial strains

    • Measure reporter gene expression as an indicator of protein interaction

    • This system is particularly useful for membrane proteins like MesE and MesD

  • FRET (Fluorescence Resonance Energy Transfer):

    • Generate fluorescent protein fusions with MesE and MesD

    • Express in bacterial cells or reconstitute in membrane models

    • Measure energy transfer as an indicator of protein proximity

    • This technique provides spatial information about the interaction

  • Cross-linking Studies:

    • Treat cells expressing MesE and MesD with chemical cross-linkers

    • Isolate cross-linked complexes

    • Analyze by mass spectrometry to identify interaction domains

    • This approach can capture transient interactions during the transport process

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified MesE or MesD on sensor chips

    • Measure binding kinetics with the partner protein

    • Determine affinity constants and binding dynamics

    • This technique provides quantitative data on interaction strength

  • Mutagenesis Analysis:

    • Create systematic mutations in potential interaction domains

    • Assess effects on bacteriocin secretion efficiency

    • Complement secretion-deficient mutants with wild-type proteins

    • This approach can identify critical residues for protein-protein interactions

By combining these techniques, researchers can develop a comprehensive model of how MesE and MesD interact to form a functional bacteriocin secretion complex, including the conformational changes that occur during the transport process.

How can heterologous expression systems be optimized for studying MesE function?

Optimizing heterologous expression systems for studying MesE function requires careful consideration of several factors to ensure proper protein folding, membrane integration, and functional activity. Based on research findings, the following optimized methodological approach is recommended:

  • Host Strain Selection:

    • For basic expression: E. coli BL21(DE3) or derivatives offer high protein yields

    • For functional studies: Lactobacillus species such as L. johnsonii NCK64 provide a more native-like cellular environment for bacteriocin secretion studies

    • Gram-positive hosts are preferable when studying the complete secretion system due to membrane composition similarities with Leuconostoc

  • Expression Vector Design:

    • Include native promoter sequences for expression in lactic acid bacteria

    • For E. coli expression, use tightly controlled inducible promoters (T7, tac)

    • Incorporate appropriate signal sequences to ensure proper membrane targeting

    • Consider fusion partners that enhance membrane protein stability or aid purification

  • Culture Conditions Optimization:

    • Determine optimal induction timing (typically at mid-log phase)

    • Test various inducer concentrations to balance expression level with proper folding

    • Lower growth temperature (16-25°C) during induction to reduce inclusion body formation

    • Supplement media with glycine (1-2%) to weaken cell walls in Gram-positive hosts

  • Functional Verification Methods:

    • Bacteriocin activity assays against indicator strains (e.g., Listeria monocytogenes)

    • Complementation of MesE-deficient mutants to confirm functional expression

    • Transport assays using labeled pre-bacteriocins to measure secretion efficiency

    • In vitro reconstitution of the MesDE transport system in proteoliposomes

  • Co-expression Strategies:

    • Co-express MesE with MesD to maintain the complete transport complex

    • Include the bacteriocin structural gene (mesY) to assess complete system functionality

    • Consider expressing the entire mesentericin operon for native-like expression levels and stoichiometry

Research has demonstrated that heterologous expression in Lactobacillus johnsonii NCK64 allows for the efficient maturation and secretion of mesentericin Y105, suggesting that the bacteriocin secretion machinery has broad substrate specificity across different lactic acid bacteria species . This characteristic can be leveraged for developing industrial fermentation starters with multiple bactericidal activities.

What analytical techniques can be used to assess MesE-mediated bacteriocin secretion efficiency?

Assessing MesE-mediated bacteriocin secretion efficiency requires a multi-faceted analytical approach that combines quantitative measurements of bacteriocin production with qualitative assessments of transport function. The following comprehensive analytical framework is recommended:

  • Quantitative Bacteriocin Activity Assays:

    • Agar well diffusion assay: Measure inhibition zones against indicator organisms

    • Critical dilution assay: Determine the highest dilution showing inhibitory activity

    • Microplate growth inhibition assays: Monitor growth curves of sensitive strains

    • These methods provide functional quantification of secreted bacteriocins

  • Protein Detection Methods:

    • ELISA: Develop specific antibodies against mesentericin for quantification

    • Western blotting: Monitor both intracellular accumulation and extracellular secretion

    • Mass spectrometry: Identify and quantify bacteriocins in culture supernatants

    • These techniques can distinguish between secretion and processing defects

  • Real-time Monitoring Approaches:

    • Reporter gene fusions: Link bacteriocin secretion to measurable signals

    • Fluorescently labeled pre-bacteriocins: Track the secretion process visually

    • Biosensor cells: Use indicator strains engineered to produce signals upon bacteriocin detection

    • These methods allow for kinetic analysis of the secretion process

  • Cell Fractionation Studies:

    • Separate cellular compartments (cytoplasm, membrane, extracellular)

    • Quantify bacteriocin distribution in each fraction

    • Detect processing intermediates to pinpoint transport bottlenecks

    • This approach helps localize where secretion may be impaired in mutant systems

  • Comparative Analysis Framework:

Analytical ParameterWild-type MesEMesE MutantAnalytical Method
Bacteriocin in supernatant++++ / -ELISA/Activity assay
Intracellular pre-bacteriocin++++Western blot
Processing efficiencyCompletePartial/NoneMass spectrometry
Bacteriocin bioactivityHighLow/NoneInhibition assay
Secretion kineticsRapidSlow/NoneTime-course sampling

By systematically applying these analytical techniques, researchers can comprehensively characterize MesE function in bacteriocin secretion, identify rate-limiting steps in the transport process, and evaluate the impact of mutations or experimental conditions on secretion efficiency .

How can site-directed mutagenesis be used to identify critical domains in MesE for bacteriocin transport?

Site-directed mutagenesis provides a powerful approach for identifying critical functional domains within the MesE protein structure. Based on research findings, the following systematic mutagenesis strategy is recommended for characterizing MesE domains involved in bacteriocin transport:

  • Rational Target Selection:

    • Transmembrane domains: Identify predicted membrane-spanning regions using bioinformatics tools

    • Conserved motifs: Target residues conserved across MesE homologs from different species

    • Predicted interaction interfaces: Focus on regions likely to interact with MesD or pre-bacteriocins

    • Charged residues in predicted functional domains: These often play key roles in protein-protein interactions

  • Mutation Strategy Design:

    • Conservative substitutions: Replace amino acids with those of similar properties to assess tolerance

    • Non-conservative substitutions: Change amino acid properties dramatically to disrupt function

    • Alanine scanning: Systematically replace residues with alanine to identify essential side chains

    • Domain deletions: Remove entire predicted functional domains to assess their necessity

  • Expression and Functional Analysis:

    • Express mutant MesE proteins in MesE-deficient strains

    • Quantify bacteriocin secretion efficiency using methods described in section 4.2

    • Assess protein expression, stability, and membrane localization

    • Analyze interactions with MesD and pre-bacteriocins using co-immunoprecipitation or two-hybrid approaches

  • Suggested Priority Targets for Mutagenesis:

Domain/RegionTarget ResiduesMutation StrategyExpected Effect
N-terminal transmembraneHydrophobic residuesConservative substitutionsAltered membrane anchoring
MesD interaction domainCharged clustersCharge reversalDisrupted complex formation
Periplasmic domainConserved motifsAlanine scanningImpaired channel formation
C-terminal regionTerminal 20 aaTruncationsAltered bacteriocin recognition
  • Integrated Structure-Function Analysis:

    • Map functional data from mutagenesis onto structural predictions

    • Correlate secretion defects with specific molecular interactions

    • Build a comprehensive model of domain functions within MesE

Research has shown that this approach successfully identified critical regions in the MesE protein from different Leuconostoc strains, despite their sequence differences . The mapping of functional domains provides valuable insights for protein engineering applications and for understanding the molecular mechanism of bacteriocin transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.