Recombinant Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase type 3 (HSD3B3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HSD3B3; NADPH-dependent 3-keto-steroid reductase HSD3B3; 3 beta-hydroxysteroid dehydrogenase type 3; 3 beta-hydroxysteroid dehydrogenase type III; 3 beta-HSD III; Dihydrotestosterone 3-ketoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Mesocricetus auratus (Golden hamster)
Target Names
HSD3B3
Target Protein Sequence
PAWSCLVTGAGGFLGQRIIRMLAQEKELQEVRTLFRSFTPKHREELSKLQTKTKVTVLEG DILDAQCLRRACQGISVVIHTAAAIDVFGAIPRQTVIDINLKGTQHLLDACIGARVPVFI YSSSVAVAGPNSYKVIIQNGSEEENHESTWSDPYAYSKKMAEKAVLAANGSTLKDGGTLH TCALRLPFIYGEKSKFISDTMDRALKNNGLINGFSRFSVISSVYVNNAAWAHVLAARGLQ DPKKSPNIQGQFYYISDDTPHQSYDDLCYTLSKDWGLRPDSSWKPPVALLYWFGFLLETV SFLLRPVYNYQPPFNRHLVTLLNSVFTFSYKKAQRDLGYEPLVSWEEAREKTSEWIGSLV EQHKGTLNIKAQ
Uniprot No.

Target Background

Function

Recombinant Mesocricetus auratus 3β-hydroxysteroid dehydrogenase type 3 (HSD3B3) reduces the oxo group at the C-3 position of 5α-androstane steroids. It catalyzes the conversion of dihydrotestosterone to its inactive form, 5α-androstanediol, which does not bind to the androgen receptor (AR). This enzyme does not function as an isomerase.

Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
High levels in adrenal gland, kidney and male liver (at protein level). Low levels in female liver (at protein level). Expressed in ovaries (at protein level).

Q&A

What is the biological function of HSD3B3 in Mesocricetus auratus?

HSD3B3 (3 beta-hydroxysteroid dehydrogenase type 3) in Mesocricetus auratus (Golden hamster) functions as a critical enzyme in steroid hormone biosynthesis. This enzyme catalyzes the oxidative conversion of delta-5-3-beta-hydroxysteroids to delta-4-3-ketosteroids, an essential step in the production of all classes of steroid hormones, including progesterone, glucocorticoids, mineralocorticoids, androgens, and estrogens . The enzyme also exhibits isomerase activity, facilitating the conversion between different molecular configurations. Research indicates that the HSD3B3 gene leads to decreased NADPH binding to tyrosine, affecting its catalytic efficiency in certain conditions .

What are the structural characteristics of recombinant HSD3B3?

Recombinant Mesocricetus auratus HSD3B3 is typically produced as a partial protein with specific structural features that maintain its functional domains. The protein is identified in the UniProt database under accession number O35296 . Alternative nomenclature includes 3 beta-hydroxysteroid dehydrogenase type III (3-beta-HSD III), 3-beta-hydroxy-5-ene steroid dehydrogenase, and NADP-dependent 3-beta-hydroxy-Delta . The protein contains conserved regions essential for substrate binding and catalytic activity, with specific amino acid residues critical for NADPH binding and enzyme function. The recombinant version is typically expressed in yeast expression systems to maintain proper folding and post-translational modifications .

How should HSD3B3 be stored and handled in laboratory settings?

For optimal stability and activity of recombinant HSD3B3, specific storage conditions must be maintained. The shelf life is influenced by multiple factors including buffer composition, storage temperature, and the protein's inherent stability properties . For liquid formulations, a shelf life of approximately 6 months can be expected when stored at -20°C to -80°C . Lyophilized forms demonstrate greater stability, with a shelf life of up to 12 months at -20°C to -80°C .

For routine laboratory use, researchers should:

  • Briefly centrifuge vials before opening to collect contents at the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for no more than one week

  • Avoid repeated freezing and thawing as this significantly reduces enzyme activity

What are the recommended protocols for reconstitution and activation of recombinant HSD3B3?

The reconstitution protocol for recombinant HSD3B3 requires careful attention to buffer conditions and protein concentration to maintain enzymatic activity. Begin by centrifuging the protein vial briefly to ensure all material is at the bottom . For reconstitution, use deionized sterile water to achieve a final concentration between 0.1-1.0 mg/mL . The exact concentration may be optimized based on your specific experimental requirements.

For long-term storage stability, glycerol should be added to a final concentration of 5-50% . The standard recommendation is 50% glycerol for maximum protection against freeze-thaw damage. After reconstitution, the protein solution should be divided into small single-use aliquots to prevent repeated freeze-thaw cycles that can dramatically decrease enzymatic activity . Each aliquot should be flash-frozen in liquid nitrogen before transferring to -80°C for long-term storage.

Before experimental use, thaw aliquots rapidly in a 37°C water bath and keep on ice until needed. For optimal enzyme activity, the reconstitution buffer may be supplemented with appropriate cofactors including NAD+ or NADP+ depending on the specific reaction being studied.

How can enzyme kinetics of HSD3B3 be accurately measured and analyzed?

Accurate measurement of HSD3B3 enzyme kinetics requires specialized spectrophotometric or chromatographic techniques. The most common approach utilizes a coupled enzyme assay that monitors the conversion of NAD+ to NADH or NADP+ to NADPH at 340 nm during the oxidation reaction. This methodology allows for real-time monitoring of reaction progress.

For kinetic analysis, prepare a reaction mixture containing:

  • Purified recombinant HSD3B3 (0.1-1.0 μg/mL)

  • Appropriate buffer (typically 50-100 mM phosphate or Tris buffer, pH 7.4)

  • Cofactor (NAD+ or NADP+, 1-2 mM)

  • Substrate (pregnenolone or other appropriate Δ5-3β-hydroxysteroid)

  • Optional stabilizers (1-5 mM DTT or 2-mercaptoethanol)

Measure initial reaction velocities across a range of substrate concentrations (0.1-10 × Km value) while maintaining constant enzyme concentration. Plot the data using Lineweaver-Burk, Eadie-Hofstee, or non-linear regression analysis to determine kinetic parameters (Km, Vmax, kcat).

Inhibition studies can be conducted by adding potential inhibitors to the reaction mixture and comparing kinetic parameters to control conditions. Analysis of product formation can be further verified using HPLC or LC-MS techniques for more precise quantification of reaction products and identification of potential intermediates.

What expression systems are most effective for producing functional recombinant HSD3B3?

The production of functional recombinant HSD3B3 has been successfully achieved using yeast expression systems, which provide appropriate eukaryotic processing capabilities . Yeast systems (particularly Saccharomyces cerevisiae and Pichia pastoris) offer several advantages for HSD3B3 expression, including proper protein folding, post-translational modifications, and the ability to secrete the target protein into the medium.

For optimal expression:

  • Clone the HSD3B3 gene into an appropriate yeast expression vector containing a strong inducible promoter (e.g., AOX1 for P. pastoris or GAL1 for S. cerevisiae)

  • Include a secretion signal (e.g., α-factor) to facilitate extracellular expression

  • Transform the construct into a protease-deficient yeast strain to minimize degradation

  • Optimize culture conditions (temperature, pH, media composition) to maximize yield

  • Induce expression using appropriate carbon sources (methanol for P. pastoris or galactose for S. cerevisiae)

  • Harvest and purify using affinity chromatography based on the incorporated tag

Alternative expression systems that may be considered include mammalian cell lines (HEK293, CHO) for enhanced post-translational modifications, insect cell systems (Sf9, Sf21) using baculovirus vectors, or bacterial systems (E. coli) with specialized folding approaches for simpler production workflows.

How can HSD3B3 be utilized in studies of steroid hormone biosynthesis pathways?

Recombinant HSD3B3 serves as a valuable tool for investigating steroid hormone biosynthesis pathways in comparative endocrinology research. To effectively utilize this enzyme in pathway studies, researchers can implement several approaches:

  • Reconstitute in vitro steroidogenic pathways by combining purified recombinant HSD3B3 with other steroidogenic enzymes (CYP11A1, CYP17A1, CYP21A2) to study sequential conversion of precursors to active hormones.

  • Use isotope-labeled substrates (3H or 14C-pregnenolone) to track metabolic flux through the pathway, quantifying intermediates and end products via chromatographic analysis.

  • Employ specific HSD3B inhibitors (trilostane, epostane) alongside recombinant HSD3B3 to determine rate-limiting steps and regulatory control points in the pathway.

  • Conduct comparative analyses between HSD3B3 and other HSD3B isoforms (HSD3B1, HSD3B2) to elucidate species-specific or tissue-specific variations in steroidogenic capacity.

This methodological approach provides insights into the unique roles of HSD3B3 in the hamster steroidogenic pathway, potentially revealing evolutionary adaptations in hormone synthesis across different mammalian species.

What approaches can be used to study the impact of mutations in the HSD3B3 gene on enzyme function?

Investigating the functional consequences of HSD3B3 mutations requires a systematic approach combining molecular biology, biochemistry, and computational methods:

  • Site-directed mutagenesis of recombinant HSD3B3:

    • Design primers targeting specific residues of interest, particularly those involved in NADPH binding

    • Create a library of mutant constructs with single amino acid substitutions

    • Express and purify mutant proteins using the yeast expression system

  • Functional characterization:

    • Perform enzyme kinetic analysis comparing wild-type and mutant enzymes

    • Determine changes in substrate binding affinity (Km), catalytic efficiency (kcat/Km), and reaction velocity (Vmax)

    • Assess thermal stability profiles using differential scanning fluorimetry

    • Evaluate cofactor binding using isothermal titration calorimetry

  • Structural analysis:

    • Generate homology models based on crystal structures of related enzymes

    • Perform molecular dynamics simulations to predict conformational changes

    • Use in silico docking studies to visualize altered substrate interactions

Of particular interest are mutations affecting tyrosine residues involved in NADPH binding, as these have been linked to decreased cofactor affinity and reduced catalytic activity in HSD3B3 .

How does HSD3B3 expression correlate with cancer stem cell markers and disease progression?

Recent research has revealed intriguing connections between dehydrogenase enzymes, stem cell biology, and cancer progression. Although HSD3B3 specifically has not been directly linked to cancer stem cells in the available literature, related dehydrogenases like ALDH have established roles as stem cell markers .

To investigate potential correlations between HSD3B3 and cancer progression:

  • Tissue analysis methodology:

    • Perform immunohistochemical staining of tumor tissue microarrays using anti-HSD3B3 antibodies

    • Conduct dual staining with established cancer stem cell markers (CD133, ALDH1)

    • Quantify co-expression patterns using digital pathology algorithms

    • Correlate expression levels with clinical outcomes and disease staging

  • Functional investigation:

    • Isolate putative cancer stem cell populations using flow cytometry

    • Analyze HSD3B3 expression at mRNA and protein levels in these populations

    • Perform knockdown or overexpression studies to determine effects on stemness properties

    • Assess changes in tumor-initiating capacity, self-renewal, and differentiation potential

This research approach could potentially reveal whether HSD3B3, like ALDH1, might serve as a biomarker for certain cancer types or contribute to the stemness phenotype observed in cancer stem cells .

What quality control methods ensure the purity and activity of recombinant HSD3B3?

Multiple quality control methods should be implemented to verify the purity and activity of recombinant HSD3B3 preparations:

  • Purity assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (should show >85% purity)

    • Western blot using specific anti-HSD3B3 antibodies to confirm identity

    • Size exclusion chromatography to detect aggregation or degradation products

    • Mass spectrometry to verify molecular weight and sequence coverage

  • Activity verification:

    • Spectrophotometric enzyme assays measuring NAD(P)H production at 340 nm

    • HPLC analysis of substrate-to-product conversion rates

    • Comparison to reference standards or previous batches

    • Temperature and pH activity profiles to confirm expected behavior

  • Stability testing:

    • Accelerated stability studies at elevated temperatures

    • Long-term stability monitoring at recommended storage conditions

    • Freeze-thaw cycle tolerance assessment

    • Activity retention measurements over time

The accepted quality standard for recombinant HSD3B3 is typically >85% purity as determined by SDS-PAGE , with specific activity measurements that demonstrate consistent catalytic function across production batches.

What are common challenges in HSD3B3 experimental procedures and how can they be addressed?

Researchers working with recombinant HSD3B3 frequently encounter several technical challenges that can be addressed through optimized protocols:

  • Protein instability and activity loss:

    • Challenge: Rapid decline in enzymatic activity during storage or experimental handling

    • Solution: Add stabilizing agents (glycerol 5-50%, reducing agents 1-5 mM DTT) to all buffers

    • Solution: Prepare single-use aliquots to avoid repeated freeze-thaw cycles

    • Solution: Maintain strict temperature control during purification and assays

  • Substrate solubility limitations:

    • Challenge: Poor solubility of steroid substrates in aqueous buffers

    • Solution: Prepare concentrated stock solutions in ethanol or DMSO (final solvent concentration <2%)

    • Solution: Use cyclodextrins as solubilizing agents for hydrophobic steroids

    • Solution: Implement microsomal or liposomal reconstitution systems

  • Cofactor regeneration issues:

    • Challenge: Costly NAD(P)+ consumption in large-scale reactions

    • Solution: Implement cofactor regeneration systems (glucose-6-phosphate/G6PDH)

    • Solution: Couple reactions with secondary enzymes that recycle cofactors

    • Solution: Optimize cofactor:enzyme ratios to minimize consumption

  • Interference from contaminating activities:

    • Challenge: Presence of endogenous dehydrogenases from expression system

    • Solution: Include appropriate controls (heat-inactivated enzyme, reaction without substrate)

    • Solution: Use highly purified preparations (>95% purity) for critical experiments

    • Solution: Verify results using specific inhibitors of HSD3B enzymes

How does HSD3B3 compare functionally to other HSD3B isoforms across species?

The functional comparison between HSD3B3 and other isoforms reveals important evolutionary and physiological insights. HSD3B3 from Mesocricetus auratus (golden hamster) exhibits distinctive characteristics compared to other isoforms and species variants:

FeatureHSD3B3 (Hamster)HSD3B1 (Hamster)HSD3B1 (Human)HSD3B2 (Human)
Expression PatternAdrenal, gonadal tissuesPredominantly placentalPlacenta, skin, mammaryAdrenals, gonads
Substrate PreferencePregnenenolone, DHEAPregnenenolonePregnenenolone, DHEAPregnenenolone, DHEA
Cofactor PreferenceNADP+NAD+NAD+NAD+
Catalytic EfficiencyModerateHighHighModerate
NADPH BindingDecreased binding to tyrosine residuesStandard bindingStandard bindingStandard binding
Function in SteroidogenesisSecondary pathwayPrimary in specific tissuesTissue-specificPrimary in adrenals/gonads

The decreased NADPH binding to tyrosine residues in HSD3B3 represents a significant functional divergence that affects its catalytic properties . This characteristic may reflect evolutionary adaptations in hamster steroidogenic pathways compared to other mammals. The functional differences between isoforms provide valuable insights into tissue-specific steroid metabolism and potential therapeutic targets for conditions involving dysregulated steroidogenesis.

What is the significance of studying HSD3B3 in relation to stem cell research?

Though direct evidence linking HSD3B3 specifically to stem cell function is limited in the current literature, investigating this relationship offers promising research directions. Related dehydrogenases such as ALDH have established roles as stem cell markers , suggesting potential parallels with HSD3B3 function.

Methodological approaches for exploring this relationship include:

  • Comparative expression analysis:

    • Profile HSD3B3 expression in pluripotent, multipotent, and differentiated cell populations

    • Correlate expression levels with stemness markers (Oct4, Nanog, Sox2)

    • Track expression changes during differentiation processes

    • Analyze epigenetic regulation of HSD3B3 in stem cell populations

  • Functional investigation:

    • Perform gain/loss-of-function studies in stem cell models

    • Assess impacts on self-renewal, pluripotency, and differentiation capacity

    • Investigate metabolic roles in stem cell maintenance

    • Evaluate potential contributions to stem cell resistance to stress conditions

Understanding HSD3B3's role in stem cell biology could illuminate novel functions beyond its established role in steroidogenesis. The enzyme may participate in specialized metabolic pathways that support stem cell maintenance or differentiation, similar to how ALDH activity has been linked to stem cell function through retinoic acid signaling pathways and protection against oxidative stress .

How can recombinant HSD3B3 be applied in drug discovery and development research?

Recombinant HSD3B3 offers valuable applications in pharmaceutical research and drug development:

  • High-throughput screening platforms:

    • Develop fluorescence-based assays for rapid compound screening

    • Implement cell-based reporter systems incorporating HSD3B3

    • Create immobilized enzyme reactors for continuous screening

    • Design computational models for in silico screening based on enzyme structure

  • Lead optimization strategies:

    • Evaluate structure-activity relationships of potential inhibitors

    • Assess species-specific differences in drug interactions

    • Determine selectivity profiles across different HSD3B isoforms

    • Conduct medicinal chemistry refinement based on binding interactions

  • Therapeutic target validation:

    • Create animal models with modified HSD3B3 expression or function

    • Correlate enzyme activity with disease phenotypes

    • Evaluate potential off-target effects on steroidogenic pathways

    • Develop biomarkers for monitoring therapeutic efficacy

The unique characteristics of hamster HSD3B3, particularly its altered NADPH binding properties , provide a distinctive model for studying selective modulation of steroidogenic enzymes. This research has potential applications in developing treatments for hormone-dependent conditions, metabolic disorders, and reproductive health issues.

What emerging technologies can enhance the study of HSD3B3 structure and function?

Cutting-edge technologies are revolutionizing the investigation of enzymes like HSD3B3, offering unprecedented insights into structure-function relationships. Researchers should consider these methodological approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of HSD3B3 at near-atomic resolution without crystallization

    • Captures dynamic states of the enzyme during catalytic cycle

    • Reveals conformational changes upon substrate or cofactor binding

    • Provides structural insights into enzyme complexes with regulatory proteins

  • AlphaFold and advanced protein modeling:

    • Generates highly accurate structural predictions based on amino acid sequence

    • Facilitates comparative modeling between HSD3B isoforms across species

    • Predicts impacts of mutations on protein stability and function

    • Guides rational design of selective inhibitors or activity enhancers

  • Single-molecule enzymology:

    • Tracks individual enzyme molecules during catalysis

    • Reveals heterogeneity in enzyme behavior masked in bulk experiments

    • Identifies transient intermediates and conformational states

    • Provides precise kinetic parameters free from ensemble averaging effects

  • CRISPR-based genomic engineering:

    • Creates precise modifications to endogenous HSD3B3 genes

    • Enables real-time visualization of enzyme expression and localization

    • Facilitates screening of regulatory elements controlling expression

    • Generates cellular and animal models with specific HSD3B3 variants

These methodological advances will significantly enhance our understanding of the unique structural features responsible for HSD3B3's distinctive NADPH binding properties and catalytic mechanisms .

How might HSD3B3 research contribute to advancements in reproductive medicine?

The study of HSD3B3 has important implications for reproductive medicine, particularly given its role in steroid hormone biosynthesis. Strategic research in this area could lead to significant clinical applications:

  • Fertility treatment approaches:

    • Develop targeted modulators of HSD3B3 activity to regulate specific steroidogenic pathways

    • Create diagnostic tools to assess enzyme function in reproductive tissues

    • Engineer in vitro systems recreating steroidogenic pathways for gamete maturation

    • Investigate species-specific variations to improve animal breeding programs

  • Hormonal disorder management:

    • Identify HSD3B3 polymorphisms associated with endocrine disorders

    • Design selective inhibitors for conditions involving aberrant enzyme activity

    • Develop personalized treatment approaches based on individual enzyme variants

    • Create biomarkers for monitoring treatment efficacy

  • Aging and reproductive senescence:

    • Characterize changes in HSD3B3 expression and activity throughout the lifespan

    • Correlate alterations with age-related declines in fertility

    • Identify interventions to maintain optimal enzyme function during aging

    • Develop targeted approaches to address specific enzyme deficiencies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.