Recombinant Mesocricetus auratus Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Mesocricetus auratus DAD1 is a 113-amino acid protein (residues 2–113 of the mature protein) expressed in E. coli with an N-terminal His tag for purification . It is a subunit of the OST complex, which catalyzes the transfer of oligosaccharides to asparagine residues in nascent polypeptides during N-linked glycosylation .

Amino Acid Sequence:

The sequence SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG reveals two transmembrane domains, consistent with its role as an integral membrane protein in the endoplasmic reticulum (ER) .

Functional Role:

  • OST Complex Participation: DAD1 stabilizes the OST complex alongside ribophorins I/II and OST48. Crosslinking studies confirm direct interactions with OST48 and ribophorin II .

  • Anti-Apoptotic Activity: Depletion of DAD1 disrupts N-glycosylation, triggering apoptosis in temperature-sensitive cell lines (e.g., tsBN7) . This pathway is independent of Bcl-2 but involves MCL1 interactions .

Applications in Research

Recombinant DAD1 is utilized in:

  • Enzymatic Assays: Studying OST activity and N-glycosylation mechanisms .

  • Apoptosis Studies: Investigating ER stress-induced cell death pathways .

  • Structural Biology: Mapping OST subunit interactions via crosslinking and sedimentation analyses .

  • Diagnostic Development: Serving as an antigen in ELISA kits (e.g., CSB-CF006487MRG) .

Comparative Analysis with Orthologs

DAD1 is evolutionarily conserved across species:

SpeciesIdentity to Hamster DAD1Key Function
Human (Homo sapiens)91%OST subunit; apoptosis regulation
Yeast (S. cerevisiae)40% (Ost2p)OST complex stability
Plants (e.g., Soybean)47–61%Pathogen defense and ER stress response

Critical Studies:

  • OST Subunit Validation: Immunoblot and crosslinking experiments confirmed DAD1’s stoichiometric equivalence to ribophorins and OST48 in purified OST complexes .

  • Glycosylation Defects: Temperature-induced DAD1 degradation in tsBN7 cells led to underglycosylated ribophorins and secretory proteins, proving its essential role in OST function .

  • Therapeutic Relevance: DAD1 downregulation correlates with tumor progression (e.g., pancreatic tumors), highlighting its potential as a biomarker .

Future Directions

Current research focuses on:

  • Mechanistic Links: How DAD1 loss directly activates apoptotic cascades beyond glycosylation defects .

  • Biotechnological Engineering: Optimizing DAD1-containing OST complexes for glycoprotein production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
DAD1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-113
Protein Length
Full Length of Mature Protein
Species
Mesocricetus auratus (Golden hamster)
Target Names
Target Protein Sequence
SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Uniprot No.

Target Background

Function
DAD1 is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process is the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally, and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for maximal enzyme activity.
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biological function of DAD1 in Mesocricetus auratus?

DAD1 (defender against cell death 1) in Mesocricetus auratus functions as an essential subunit of the N-oligosaccharyl transferase (OST) complex. This complex catalyzes the transfer of high mannose oligosaccharides from lipid-linked oligosaccharide donors to asparagine residues within Asn-X-Ser/Thr consensus motifs in nascent polypeptide chains. The N-glycosylation process occurs cotranslationally, with the complex associating with the Sec61 complex at the channel-forming translocon that mediates protein translocation across the endoplasmic reticulum (ER). Most importantly, DAD1 serves as a negative regulator of programmed cell death, with loss of the DAD1 protein triggering apoptosis .

The Syrian hamster DAD1 participates in two significant biological pathways:

  • N-Glycan biosynthesis (protein glycosylation)

  • Protein processing in the endoplasmic reticulum

What is the role of DAD1 in the context of the Syrian hamster as an experimental model?

The Syrian hamster (Mesocricetus auratus) has gained importance as an experimental animal model for multiple pathogens, including emerging zoonotic diseases such as Ebola . DAD1's role as a defender against apoptotic cell death makes it particularly relevant for research involving infectious disease pathogenesis, where cellular death pathways are often manipulated by pathogens.

Understanding DAD1 function in Syrian hamsters provides insights into host-pathogen interactions, particularly in how viral infections may disrupt normal cellular processes like N-glycosylation or apoptosis regulation. The characterization of the Syrian hamster transcriptome, which includes DAD1, has significantly improved the utility of this species in infectious disease research .

What methodologies are recommended for recombinant expression of Mesocricetus auratus DAD1?

For recombinant expression of Mesocricetus auratus DAD1, a systematic approach is necessary due to the protein's transmembrane nature and involvement in complex formation:

  • Gene Synthesis and Vector Design:

    • Optimize the DAD1 coding sequence for expression in your chosen system

    • Design expression vectors with appropriate tags (His6, FLAG, etc.) that won't interfere with protein function

    • Consider including TEV protease cleavage sites if tag removal is required post-purification

  • Expression System Selection:

    • Mammalian cell expression systems (HEK293, CHO) are preferred for proper folding and post-translational modifications

    • Insect cell systems (Sf9, Hi5) offer a good compromise between yield and proper folding

    • E. coli systems may be suitable for truncated versions lacking transmembrane domains

  • Expression Conditions:

    • For mammalian cells: Transfect with optimized DNA:transfection reagent ratios, harvest 48-72 hours post-transfection

    • For insect cells: Use recombinant baculovirus with MOI of 1-5, harvest 48-72 hours post-infection

    • Include protease inhibitors during harvest to prevent protein degradation

  • Purification Strategy:

    • Detergent solubilization (1% DDM, CHAPS, or Triton X-100) for membrane extraction

    • Affinity chromatography using tag-specific resins

    • Size exclusion chromatography for final purification and buffer exchange

How can researchers design experiments to study DAD1's role in apoptosis in Mesocricetus auratus cell lines?

Designing robust experiments to study DAD1's role in apoptosis requires careful consideration of experimental controls and methodology:

  • Experimental Design Approach:

    • Use true experimental research design with appropriate control and experimental groups

    • Implement randomization to minimize bias

    • Include technical and biological replicates (minimum n=3 for each)

  • DAD1 Knockdown/Knockout Strategies:

    • siRNA transfection for transient knockdown

    • CRISPR-Cas9 for stable knockout cell lines

    • Temperature-sensitive systems mimicking the tsBN7 cell line model

  • Apoptosis Detection Methods:

    MethodMarkerTimepointAdvantagesLimitations
    Annexin V/PI stainingPhosphatidylserine externalization12-24h post-treatmentDistinguishes early/late apoptosisFlow cytometer required
    TUNEL assayDNA fragmentation24-48h post-treatmentWorks with fixed tissueFalse positives possible
    Caspase activityCaspase-3/7 activation6-12h post-treatmentQuantitativeMay miss caspase-independent apoptosis
    Western blotCleaved PARP, caspase cleavageVariousProtein-specific analysisSemi-quantitative
  • Data Collection and Analysis:

    • Document morphological changes using time-lapse microscopy

    • Quantify apoptotic markers at multiple time points

    • Use statistical analysis (ANOVA, t-test) to determine significance

    • Consider survival curve analysis for time-to-apoptosis studies

What considerations are important when designing primers for cloning and qPCR analysis of Mesocricetus auratus DAD1?

Primer design for DAD1 research requires attention to species-specific sequence features and technical parameters:

  • Genomic and Transcript Considerations:

    • Reference the Syrian hamster transcriptome data (60,117,204 nucleotides)

    • Account for potential splice variants or isoforms

    • Check for species-specific sequence variations that may affect primer binding

  • Cloning Primers Design:

    • Include appropriate restriction sites with 3-6 base overhangs

    • Ensure in-frame fusion with tags or reporter proteins

    • Verify no internal restriction sites within the DAD1 sequence

    • Optimal length: 25-35 nucleotides including restrictions sites

  • qPCR Primers Design:

    • Target amplicon size: 80-150 bp

    • Primer length: 18-22 nucleotides

    • GC content: 40-60%

    • Tm: 58-62°C with <2°C difference between primer pairs

    • Avoid secondary structures and primer-dimers

    • Span exon-exon junctions to prevent genomic DNA amplification

  • Validation Experiments:

    • Perform gradient PCR to determine optimal annealing temperature

    • Verify amplicon identity by sequencing

    • Check primer efficiency using standard curve analysis

    • Validate reference genes for normalization in Syrian hamster tissues

How does DAD1 interact with the glycosylation machinery in Mesocricetus auratus compared to other model organisms?

DAD1's interaction with the glycosylation machinery in Mesocricetus auratus follows patterns similar to other mammals but with species-specific characteristics:

  • OST Complex Integration:
    The Syrian hamster DAD1 functions as an essential subunit of the oligosaccharyltransferase (OST) complex, similar to human and mouse models. It associates with other OST subunits to form a functional complex that facilitates N-linked glycosylation at the ER membrane .

  • Comparative Complex Architecture:
    Analysis of Syrian hamster transcriptome data indicates conservation of OST complex components across rodents, including mice and rats . While the core machinery remains conserved, subtle species-specific sequence variations may influence protein-protein interactions within the complex.

  • Functional Complementation:
    Experimental approaches using cross-species complementation have shown that DAD1 homologs can often functionally substitute for each other, demonstrating evolutionary conservation of this critical protein. The Syrian hamster DAD1 likely shares this functional compatibility with other mammalian homologs.

  • Species-Specific Glycosylation Patterns:
    Despite conservation of the OST complex, downstream glycosylation patterns show species-specific variations. These differences result from variable expression of glycosyltransferases and glycosidases that process the initial N-linked glycan after DAD1-facilitated transfer.

What are the implications of DAD1 dysfunction in disease models using Mesocricetus auratus?

DAD1 dysfunction in Syrian hamster models has significant implications for disease research:

  • Infectious Disease Models:
    The Syrian hamster serves as an important experimental model for multiple pathogens, including Ebola virus . DAD1 dysfunction may alter glycosylation patterns of viral envelope proteins or host receptors, potentially affecting viral entry, replication, and immune evasion strategies.

  • Apoptosis Dysregulation:
    As a defender against cell death, DAD1 dysfunction leads to inappropriate apoptosis . In disease models, this could manifest as:

    • Enhanced tissue damage in infectious disease models

    • Altered immune response due to premature immune cell death

    • Disrupted tissue homeostasis and regeneration

  • Glycosylation-Related Pathologies:
    N-linked glycosylation defects resulting from DAD1 dysfunction can lead to:

    • Protein misfolding and ER stress

    • Altered cell surface receptor function

    • Disrupted immune recognition and signaling

    • Developmental abnormalities in embryonic models

  • Cancer Models:
    DAD1 has been shown to interact with MCL1, a member of the Bcl-2 family involved in cancer progression . This interaction suggests potential roles in:

    • Tumor cell survival pathways

    • Resistance to apoptosis-inducing therapies

    • Cancer cell adaptation to stress conditions

How can researchers utilize protein-protein interaction studies to characterize DAD1's molecular network in Mesocricetus auratus?

Characterizing DAD1's molecular interaction network in Syrian hamsters requires specialized approaches:

  • Co-Immunoprecipitation (Co-IP) Studies:

    • Use epitope-tagged recombinant DAD1 or antibodies against endogenous DAD1

    • Extract proteins under native conditions using mild detergents

    • Identify interacting partners using mass spectrometry

    • Validate key interactions with reciprocal Co-IP and Western blotting

  • Proximity Labeling Approaches:

    • Generate BioID or APEX2 fusion constructs with DAD1

    • Express in Syrian hamster cells or tissues

    • Activate proximity labeling to biotinylate nearby proteins

    • Purify and identify labeled proteins by mass spectrometry

  • Yeast Two-Hybrid Screening:

    • Use DAD1 as bait against a Syrian hamster cDNA library

    • Screen for positive interactions and validate in mammalian systems

    • Map interaction domains using truncation mutants

    • Consider membrane yeast two-hybrid systems for transmembrane regions

  • Cross-Linking Mass Spectrometry (XL-MS):

    • Apply chemical cross-linkers to preserve transient interactions

    • Digest cross-linked complexes and analyze by specialized MS workflows

    • Identify distance constraints between interacting proteins

    • Generate structural models of DAD1-containing complexes

  • Functional Validation Strategies:

    • Create interaction-deficient mutants based on structural predictions

    • Assess functional consequences of disrupted interactions

    • Monitor glycosylation efficiency using reporter substrates

    • Evaluate apoptosis susceptibility in cells expressing mutant DAD1

What statistical approaches are recommended for analyzing DAD1 expression data in different tissues of Mesocricetus auratus?

Statistical analysis of DAD1 expression across tissues requires rigorous approaches:

  • Preprocessing and Normalization:

    • Apply appropriate normalization methods (RPKM, TPM, or DESeq2 normalization)

    • Assess data quality through principal component analysis

    • Filter low-expression data to reduce noise

    • Log-transform data if not normally distributed

  • Differential Expression Analysis:

    ApproachUse CaseAdvantagesStatistical Test
    Pairwise comparisonTwo tissue typesSimple interpretationt-test or Wilcoxon
    Multi-tissue comparison>2 tissue typesComprehensive analysisANOVA or Kruskal-Wallis
    Time-course analysisDevelopmental stagesCaptures temporal patternsEDGE or timecourse
    Condition-dependent expressionDisease vs. healthyDetects pathological changesDESeq2 or edgeR
  • Correlation Analysis:

    • Pearson or Spearman correlation to identify genes co-expressed with DAD1

    • Hierarchical clustering to group tissues by expression patterns

    • Network analysis to place DAD1 within functional modules

  • Validation Strategies:

    • qPCR confirmation of key findings

    • Western blot analysis for protein-level validation

    • Cross-reference with mouse/rat data from the Syrian hamster transcriptome study

    • Use appropriate reference genes established for Syrian hamster tissues

How can researchers effectively design and interpret experiments investigating the relationship between DAD1 and apoptosis regulation?

Designing and interpreting experiments on DAD1's role in apoptosis requires careful consideration:

  • Experimental Design Framework:

    • Use true experimental research design with proper controls

    • Include dose-response and time-course elements

    • Plan for both gain-of-function and loss-of-function approaches

    • Consider physiological relevance of experimental conditions

  • Data Collection Strategy:

    • Employ multiple complementary apoptosis assays

    • Collect time-resolved data to capture the apoptotic process

    • Include markers for both early and late apoptotic events

    • Document morphological changes through imaging

  • Interpretation Guidelines:

    • Establish clear criteria for defining apoptotic vs. non-apoptotic cells

    • Use positive controls (e.g., staurosporine treatment) as reference

    • Consider the kinetics of the apoptotic response

    • Account for heterogeneity in cellular responses

  • Statistical Analysis Approach:

    • Apply appropriate statistical tests based on data distribution

    • Use survival analysis for time-to-apoptosis data

    • Calculate effect sizes to quantify biological significance

    • Implement multiple test correction for high-dimensional data

  • Mechanistic Integration:

    • Correlate DAD1 levels with apoptotic markers

    • Investigate downstream effectors in the apoptotic cascade

    • Consider connections between glycosylation defects and ER stress

    • Examine potential interactions with known apoptosis regulators like MCL1

What are the key considerations for analyzing DAD1 sequence variations in Mesocricetus auratus compared to other species?

Comparative sequence analysis of DAD1 requires systematic evaluation:

  • Sequence Alignment Strategy:

    • Employ multiple sequence alignment tools (Clustal Omega, MUSCLE, T-Coffee)

    • Align at both nucleotide and amino acid levels

    • Consider structural alignment for 3D conservation analysis

    • Use PAM or BLOSUM substitution matrices appropriate for evolutionary distance

  • Conservation Analysis:

    • Calculate sequence identity and similarity percentages

    • Identify conserved motifs and functional domains

    • Locate species-specific variations

    • Map conservation onto structural models if available

  • Evolutionary Analysis:

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Calculate evolutionary rates using relative rate tests

    • Identify sites under positive or negative selection

    • Consider synteny analysis to examine genomic context conservation

  • Functional Prediction:

    • Use in silico tools to predict effects of sequence variations

    • Identify potential post-translational modification sites

    • Analyze transmembrane domain conservation

    • Predict protein-protein interaction interfaces

  • Validation Approaches:

    • Design experiments to test functional equivalence between orthologs

    • Create chimeric proteins to map species-specific functional regions

    • Test complementation in knockout systems

    • Verify predictions through site-directed mutagenesis

What are common challenges in expressing and purifying recombinant Mesocricetus auratus DAD1, and how can they be addressed?

Researchers working with recombinant DAD1 face several technical challenges:

  • Low Expression Yields:

    • Challenge: DAD1 is a transmembrane protein that may be toxic when overexpressed

    • Solution: Use inducible expression systems with tight regulation

    • Approach: Optimize induction conditions (temperature, inducer concentration, time)

    • Alternative: Consider fusion tags that enhance solubility (MBP, SUMO)

  • Protein Aggregation:

    • Challenge: Transmembrane regions prone to aggregation during expression/purification

    • Solution: Screen multiple detergents for extraction (DDM, CHAPS, LMNG)

    • Approach: Test co-expression with OST complex partners to stabilize structure

    • Alternative: Express truncated versions lacking transmembrane regions

  • Protein Instability:

    • Challenge: Purified DAD1 may exhibit limited stability in solution

    • Solution: Optimize buffer conditions (pH, salt, additives like glycerol)

    • Approach: Perform thermal shift assays to identify stabilizing conditions

    • Alternative: Consider nanodiscs or amphipols for membrane protein stabilization

  • Functional Assessment:

    • Challenge: Difficult to assess activity of isolated DAD1 outside OST complex

    • Solution: Develop in vitro reconstitution assays with minimal OST components

    • Approach: Use complementation assays in DAD1-deficient cell lines

    • Alternative: Assess binding to known partners like MCL1

How can researchers address conflicting results in DAD1 functional studies between different experimental systems?

Resolving conflicting research findings requires systematic investigation:

  • System-Specific Differences:

    • Compare expression levels across experimental systems

    • Evaluate post-translational modifications in different systems

    • Consider species-specific interaction partners

    • Examine subcellular localization in each system

  • Methodological Approach:

    Conflict TypeInvestigation StrategyValidation Approach
    Expression level discrepanciesQuantitative Western blot with calibrationAbsolute quantification using recombinant standards
    Functional differencesSide-by-side comparison with standardized assaysCross-validation in multiple cell types
    Interaction conflictsControlled IP conditions with identical tagsReciprocal Co-IPs and in vitro binding assays
    Phenotypic variationsDose-response studies with careful titrationRescue experiments with wild-type DAD1
  • Technical Considerations:

    • Standardize key reagents across experiments

    • Use multiple detection antibodies targeting different epitopes

    • Implement blinded analysis to reduce confirmation bias

    • Document all experimental conditions comprehensively

  • Integrative Assessment:

    • Develop a unified model that accommodates seemingly conflicting data

    • Consider context-dependent functions of DAD1

    • Evaluate threshold effects in different systems

    • Implement computational modeling to test hypotheses

What quality control measures should be implemented when working with recombinant Mesocricetus auratus DAD1?

Robust quality control is essential for reliable DAD1 research:

  • Protein Identity and Purity:

    • SDS-PAGE with Coomassie and silver staining

    • Western blot with DAD1-specific antibodies

    • Mass spectrometry for sequence confirmation

    • Size exclusion chromatography to assess homogeneity

  • Structural Integrity:

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to assess stability

    • Limited proteolysis to probe folding

    • Native PAGE to evaluate oligomeric state

  • Functional Validation:

    • Binding assays with known interaction partners

    • Glycosylation assays if incorporated into OST complex

    • Cell-based complementation in DAD1-deficient systems

    • Apoptosis protection assays

  • Storage and Stability:

    • Accelerated stability studies at different temperatures

    • Freeze-thaw testing to establish handling guidelines

    • Long-term activity monitoring

    • Detergent screening for optimal stability

  • Batch Consistency:

    • Implement standard operating procedures for production

    • Establish acceptance criteria for each QC parameter

    • Maintain reference standards for batch comparison

    • Document lot-to-lot variation and its impact on experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.