Recombinant Mesocricetus auratus Gastric inhibitory polypeptide receptor (GIPR)

Shipped with Ice Packs
In Stock

Description

Glycoprotein Characteristics

A significant characteristic of the GIPR is its nature as a glycoprotein. Studies using lectin affinity chromatography have demonstrated that the solubilized GIP-receptor complex specifically binds to lectins including wheat germ agglutinin and concanavalin A . This indicates the presence of specific sugar moieties in the receptor structure, including:

  • N-acetylglucosamine

  • Mannose

  • Probable sialic acid residues

These glycosylation patterns may play crucial roles in protein folding, stability, and potentially in ligand recognition.

Functional Mechanisms and Signaling Pathways

The GIPR functions primarily as a receptor for gastric inhibitory polypeptide (GIP), a 42-amino acid polypeptide synthesized by K cells located in the duodenum and small intestine . While initially identified for its ability to inhibit gastric acid secretion and gastrin release, subsequent research has established its potent insulinotropic effect in the presence of elevated glucose levels .

Physiological Role

The primary physiological action of the GIP-GIPR interaction is the stimulation of insulin release from pancreatic beta cells . Together with glucagon-like peptide-1 (GLP-1), GIP plays a critical role in the secretion of insulin following food consumption . This action positions GIPR as a crucial component in glucose homeostasis and metabolic regulation.

Signaling Pathways

GIPR participates in several important signaling cascades, including:

  • cAMP signaling pathway

  • Neuroactive ligand-receptor interaction

These pathways mediate the receptor's effects on insulin secretion and other metabolic processes. Upon binding of GIP to GIPR, the receptor activates heterotrimeric G proteins, initiating downstream signaling events that ultimately lead to insulin release from pancreatic beta cells.

Recombinant Production and Characterization

Commercially available Recombinant Mesocricetus auratus GIPR is produced using various expression systems, each offering specific advantages for different research applications.

Expression Systems

The recombinant protein can be produced using several host systems:

  • Cell-free expression systems

  • E. coli

  • Yeast

  • Baculovirus

  • Mammalian cell expression systems

The choice of expression system impacts the protein's post-translational modifications, including glycosylation patterns, which may be crucial for certain applications.

Research Applications

Recombinant Mesocricetus auratus GIPR serves as a valuable tool in diverse research applications, particularly in metabolic research and drug development.

Receptor Binding Studies

The recombinant protein enables detailed receptor binding studies, as demonstrated by research using 125I-labelled GIP cross-linking to characterize the receptor . These studies have revealed important insights into the receptor's structure and binding properties.

Early research using ultraviolet irradiation procedures successfully cross-linked 125I-GIP to its specific receptor in hamster pancreatic beta cell membranes, identifying a GIP-protein complex with an apparent molecular weight of 64,000 Da . The specificity of this binding was confirmed through competitive inhibition experiments, where increasing concentrations of native GIP (0.1 nM–1 μM) progressively inhibited the labeling of the receptor with 125I-GIP, with half-maximal inhibition observed at 5 nM .

Metabolic Research

Given the central role of GIPR in glucose homeostasis, the recombinant protein is extensively used in research focused on understanding:

  • Insulin secretion mechanisms

  • Incretin hormone action

  • Glucose metabolism

  • Pathophysiology of metabolic disorders, particularly type 2 diabetes

Potential Therapeutic Applications

Research on GIPR has implications for developing therapeutic strategies for metabolic disorders. Understanding the structure-function relationship of GIPR provides insights for designing drugs that can modulate its activity, potentially offering new approaches for treating conditions like obesity and diabetes.

Comparative Analysis with GIPR from Other Species

Recombinant GIPR proteins from various species, including human, mouse, rat, and Mesocricetus auratus (Golden hamster), are available for research purposes . This availability facilitates comparative studies to understand species-specific differences in receptor structure and function.

Conservation and Divergence

  • Ligand binding affinity

  • Signaling efficiency

  • Pharmacological responses

  • Susceptibility to modulation by potential therapeutic agents

These differences make the hamster GIPR particularly valuable for certain research applications, especially given the established role of hamster models in metabolic research.

Technical Considerations in Working with Recombinant GIPR

Researchers working with Recombinant Mesocricetus auratus GIPR should consider several technical aspects to ensure optimal experimental results.

Experimental Applications

When designing experiments using recombinant GIPR, researchers should consider:

  • Appropriate controls to validate receptor specificity

  • Careful concentration optimization based on the specific application

  • Potential interference from tags or fusion partners used in protein production

  • The influence of the expression system on post-translational modifications

Current Research Trends and Future Directions

Research involving Recombinant Mesocricetus auratus GIPR continues to evolve, with several promising directions:

Drug Discovery Applications

GIPR represents a potential target for developing therapeutics for metabolic disorders. Current approaches include:

  • Development of GIPR agonists to enhance insulin secretion

  • Creation of GIPR antagonists to modulate energy balance and weight control

  • Design of bispecific antibodies targeting GIPR and related receptors, such as the GLP-1 receptor

Integration with Omics Approaches

Combining GIPR research with genomics, proteomics, and metabolomics approaches offers opportunities to understand the receptor's role in broader physiological contexts and identify novel therapeutic targets.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
GIPR; Gastric inhibitory polypeptide receptor; GIP-R; Glucose-dependent insulinotropic polypeptide receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-462
Protein Length
Full Length of Mature Protein
Species
Mesocricetus auratus (Golden hamster)
Target Names
Target Protein Sequence
QAETDSEGQTTGELYQRWERYARECEETLTAADPPSGMVCNGSFDMYVCWDYTAANTTAQ ASCPWYLPWYRHVAAGYVFRQCGSDGQWGPWRDHTQCENPEKNGAFQDQRLILERLQVVY TVGYSLSLGTLLLALLILSLFRRLHCTRNYIHMNVFLSFMLRAVAILTRDRLLPTLGPYP GDRTLTLRNQALAACRTAQIVTQYCVGANYTWLLVEGVYLHHLLVIVGGSEKGHFRCYLL LGWGAPALFVIPWVIVRYLLENTQCWERNEVKAIWWIIRTPILITILINFFIFIRILGIL VSKLRTRQMRCPDYRLRLARSTLTLVPLLGVHEVVFAPVTEEQAEGTLRFAKLAFEIFLS SFQGFLVSVLYCFINKEVQSEIRRSWRHRVLHLSLRDERPCPHAELGPQALPSRSAPREV PITGSTLPSGPLHGPGEEVLESYC
Uniprot No.

Target Background

Function
This receptor is responsible for recognizing Gastric Inhibitory Polypeptide (GIP). The receptor's activity is mediated by G proteins, which subsequently activate adenylyl cyclase.
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely distributed including pancreatic islets, brain and various peripheral tissues.

Q&A

What methods are recommended for recombinant expression and purification of Mesocricetus auratus GIPR?

For successful recombinant expression of Mesocricetus auratus GIPR, researchers should consider the following methodological approaches:

  • Expression System Selection: Mammalian expression systems (such as HEK293 or CHO cells) are preferred over bacterial systems due to the need for appropriate post-translational modifications and proper protein folding for this transmembrane receptor.

  • Vector Construction:

    • Design a construct with appropriate kozak sequence for efficient translation initiation

    • Include a cleavable tag (His6, FLAG, or Fc) to facilitate purification

    • Consider codon optimization for the expression host

  • Purification Protocol:

    • Initial capture via affinity chromatography using the fusion tag

    • Secondary purification via size exclusion chromatography

    • For functional studies, consider detergent solubilization and reconstitution into lipid nanodiscs

  • Quality Control Assessments:

    • SDS-PAGE and western blotting to confirm molecular weight and purity

    • Mass spectrometry for sequence verification

    • Circular dichroism to assess secondary structure

    • Functional binding assays to confirm activity

Recent publications have utilized lentiviral vectors for stable expression of GIPR in cell lines, demonstrating successful functional characterization . For recombinant protein production, storage in Tris-based buffer with 50% glycerol at -20°C has been shown to maintain stability, with avoidance of repeated freeze-thaw cycles recommended .

How can researchers verify the functional activity of recombinant Mesocricetus auratus GIPR?

Verifying functional activity of recombinant GIPR requires multiple complementary approaches:

In vitro binding assays:

  • Radioligand binding: Using radiolabeled GIP to determine binding affinity (Kd value)

  • Surface Plasmon Resonance (SPR): To measure binding kinetics (kon and koff rates)

  • ELISA-based binding assays: Utilizing recombinant GIP ligand to assess receptor-ligand interaction

Functional signaling assays:

  • cAMP accumulation assay: As GIPR activates adenylyl cyclase, measuring cAMP levels using FRET-based sensors or ELISA

  • Calcium mobilization assay: Using fluorescent calcium indicators

  • β-arrestin recruitment assay: To assess receptor internalization following activation

Cell-based functional assays:

  • Overexpression studies: Assessing phenotypic changes in viability, growth, and apoptosis in cell lines

  • Inhibitor studies: Using GIPR inhibitors such as MK0893 to reverse effects and confirm specificity

  • Downstream signaling analysis: Measuring activation of pathways such as p53 signaling

A comprehensive validation approach would combine these methodologies, along with appropriate controls, including:

  • Negative control (untransfected cells)

  • Positive control (cells expressing known active GIPR)

  • Dose-response curves with GIP ligand

  • Specificity control using unrelated ligands

What are the signaling pathways and downstream effectors of GIPR in Mesocricetus auratus models?

GIPR activates complex signaling networks with context-dependent outcomes. Based on experimental findings across multiple studies:

Primary signaling cascade:

  • G-protein coupling: Upon GIP binding, GIPR predominantly couples with Gαs, leading to adenylyl cyclase activation, increased cAMP levels, and subsequent protein kinase A (PKA) activation

  • Secondary messengers: Evidence suggests GIPR can also activate phospholipase C (PLC) in certain contexts, leading to IP3 production and calcium mobilization

Downstream effectors identified in hamster models:

  • p53 pathway: Research indicates GIPR signaling involves p53 activation, which may explain its tumor suppressive effects in retinoblastoma models

  • Apoptotic regulators: GIPR overexpression increases apoptosis levels in RB cell lines, suggesting activation of pro-apoptotic factors

  • Growth inhibitory factors: GIPR activation suppresses cell viability and growth in tumor models

Regulatory mechanisms:

  • microRNA regulation: miR-542-5p has been identified as a potential regulator of GIPR expression in Mesocricetus auratus

  • Cross-talk with other signaling pathways: Evidence suggests interaction with TFF1 signaling pathways, though direct receptor-ligand interaction was not confirmed

The following table summarizes key differences between classical GIPR signaling in pancreatic β-cells versus tumor suppressor signaling in cancer cells:

Signaling ComponentClassical Metabolic SignalingTumor Suppressor Signaling
G-protein couplingPrimarily GαsGαs and potentially others
cAMP responseRapid and transientSustained
Primary outcomeInsulin secretionGrowth inhibition, apoptosis
Key effectorsPKA, Epac2p53, apoptotic factors
RegulationGlucose-dependentmiR-542-5p dependent
InhibitionHyperglycemia-induced desensitizationMK0893 reversal of effects

This dual signaling capacity makes GIPR a particularly interesting target for both metabolic and oncological research applications.

How does GIPR function differ between Mesocricetus auratus and human models in experimental settings?

Comparative analysis between hamster and human GIPR reveals important species-specific differences that researchers must consider when translating findings:

Structural differences:

  • The Mesocricetus auratus GIPR shares approximately 79% amino acid sequence homology with human GIPR, with key differences in the N-terminal extracellular domain affecting ligand binding properties

  • The hamster GIPR contains species-specific glycosylation patterns that may influence receptor trafficking and ligand recognition

Functional divergence:

  • Binding affinity: Hamster GIPR shows moderately different binding affinities for GIP compared to human GIPR, necessitating species-specific dose optimization in experimental designs

  • Signaling bias: Evidence suggests variation in G-protein coupling efficiency and β-arrestin recruitment between species

  • Pharmacological responses: The hamster GIPR shows differential sensitivity to certain antagonists compared to human GIPR

Experimental implications:

  • Cross-reactivity considerations: Antibodies and ligands designed for human GIPR may show variable cross-reactivity with Mesocricetus auratus GIPR

  • Pharmacological tool selection: Compounds like the GIPR inhibitor MK0893 demonstrate efficacy in hamster models but may require dose adjustment compared to human systems

  • Dual receptor targeting: MAR709 (NNC0090-2746), a dual GLP1R/GIPR agonist, shows balanced activity at GIPR (EC50 = 3pM) and GLP1R (EC50 = 5pM) in vitro, but species-specific potency variations must be accounted for in experimental design

When designing translational studies, researchers should implement parallel validation in both species and carefully consider these differences when interpreting results.

What experimental approaches can elucidate the potential tumor suppressor role of GIPR in cancer models?

The emerging evidence of GIPR's tumor suppressor activity, particularly in retinoblastoma, suggests several specialized experimental approaches to further characterize this function:

In vitro experimental models:

  • Stable overexpression systems: Lentiviral vector-based GIPR overexpression in cancer cell lines allows for assessment of:

    • Cell viability (MTT/WST-1 assays)

    • Proliferation rates (EdU incorporation)

    • Apoptosis levels (Annexin V/PI staining, caspase activity)

  • CRISPR/Cas9 knockout models: Generate GIPR-deficient cancer cell lines to evaluate:

    • Tumor progression acceleration

    • Resistance to apoptotic stimuli

    • Altered downstream signaling

  • Pharmacological intervention studies:

    • GIPR agonist dose-response experiments

    • Antagonist reversal studies using MK0893

    • Combination treatments with conventional chemotherapeutics

In vivo tumor models:

  • Chorioallantoic membrane (CAM) assays: As demonstrated in retinoblastoma research, CAM assays provide a rapid assessment of tumor formation capacity of GIPR-modified cells

  • Xenograft models: Implantation of GIPR-overexpressing or GIPR-knockout cells in immunocompromised mice

  • Genetic models: Development of tissue-specific GIPR overexpression in cancer-prone mouse models

Mechanistic investigation approaches:

  • Proteome profiler oncology arrays: To identify altered signaling pathways upon GIPR modulation

  • ChIP-seq analysis: To determine p53 binding sites activated downstream of GIPR signaling

  • RNA-seq: For comprehensive transcriptome analysis of GIPR-modulated cells

  • miRNA-target validation: Luciferase reporter assays to confirm miR-542-5p regulation of GIPR expression

This multi-faceted approach allows researchers to comprehensively characterize GIPR's tumor suppressive functions and identify potential therapeutic applications. Recent studies have already demonstrated that GIPR-overexpressing retinoblastoma cells develop significantly smaller tumors in CAM assays, providing a foundation for further investigation .

What are the methodological considerations for developing dual GLP1R/GIPR agonists for metabolic research using Mesocricetus auratus models?

Developing effective dual GLP1R/GIPR agonists for metabolic research in hamster models requires careful consideration of several methodological aspects:

Rational design considerations:

  • Structural basis: Utilize crystal structures of both receptors to design peptides or small molecules with balanced affinity

  • Sequence alignment: Compare hamster and human receptor sequences to identify conserved binding pockets

  • Pharmacophore modeling: Develop hybrid molecules incorporating critical binding elements for both receptors

Experimental validation pipeline:

  • In vitro receptor activation assays:

    • Measure EC50 values for both GIPR and GLP1R activation

    • Assess signaling bias across multiple pathways

    • Example: MAR709 shows balanced in vitro activity at GIPR (EC50 = 3pM) and GLP1R (EC50 = 5pM)

  • Ex vivo tissue studies:

    • Isolated islet perifusion assays to measure insulin secretion

    • Adipose tissue explants to assess lipolysis inhibition

    • Comparison with single-receptor agonists at equivalent doses

  • In vivo metabolic phenotyping:

    • Glucose tolerance tests (GTT)

    • Insulin tolerance tests (ITT)

    • Mixed-meal tolerance tests

    • Continuous glucose monitoring

    • Energy expenditure measurements

Hamster-specific model considerations:

  • Diet-induced obesity protocols: High-fat diet composition and duration must be optimized for Mesocricetus auratus

  • Genetic models: Consider hamster models of diabetes or obesity if available

  • Dosing regimens: Account for species-specific pharmacokinetics and metabolism

  • Readout parameters: Establish hamster-specific reference ranges for metabolic parameters

Comparative analysis framework:

  • Design studies that include:

    • Vehicle control

    • GIPR agonist alone

    • GLP1R agonist alone

    • Dual GIPR/GLP1R agonist

    • Co-administration of individual agonists

  • Evaluate both acute single-dose effects and chronic treatment outcomes on:

    • Weight loss efficacy

    • Glycemic improvements

    • Food intake patterns

    • Adverse effect profiles

Research has shown that in rodent models with genetic and diet-induced obesity, dual agonists like MAR709 produced greater weight loss and glycemic improvements compared to pharmacokinetically matched single-receptor agonists , highlighting the potential benefits of this approach.

What are common challenges in Mesocricetus auratus GIPR expression systems and how can they be addressed?

Researchers working with recombinant Mesocricetus auratus GIPR frequently encounter several technical challenges that can be systematically addressed:

Challenge 1: Low expression yields

  • Cause: GIPR is a transmembrane protein that can be difficult to express at high levels

  • Solutions:

    • Optimize codon usage for expression host

    • Use stronger promoters (CMV for mammalian cells)

    • Include chaperone co-expression systems

    • Test different cell lines (HEK293, CHO, Sf9)

    • Implement temperature shifts (reduce to 30°C post-induction)

Challenge 2: Protein misfolding

  • Cause: Complex disulfide bond formation and transmembrane domains

  • Solutions:

    • Express only the extracellular domain for binding studies

    • Include oxidoreductases in expression system

    • Add chemical chaperones to culture media (glycerol, DMSO at low concentrations)

    • Optimize detergent selection for membrane protein extraction

Challenge 3: Post-translational modification differences

  • Cause: Species-specific glycosylation patterns

  • Solutions:

    • Use mammalian expression systems for proper glycosylation

    • Consider glycosylation site mutations if they don't affect function

    • Implement glycosylation analysis to confirm proper processing

Challenge 4: Functional validation inconsistencies

  • Cause: Receptor activity is sensitive to experimental conditions

  • Solutions:

    • Standardize cell density and passage number

    • Control for receptor surface expression levels via flow cytometry

    • Include positive controls (known active receptor constructs)

    • Test multiple functional readouts simultaneously

    • Consider the use of GIPR inhibitor MK0893 as a negative control

Challenge 5: miRNA regulation interference

  • Cause: Endogenous miR-542-5p may regulate GIPR expression

  • Solutions:

    • Consider miRNA binding site mutations in expression constructs

    • Evaluate expression in different cell backgrounds with varying miRNA profiles

    • Use anti-miR approaches when necessary

Systematic optimization of these parameters can significantly improve reproducibility and yield of functional Mesocricetus auratus GIPR for research applications.

How can researchers reconcile contradictory findings regarding GIPR function in different experimental contexts?

The scientific literature contains seemingly contradictory findings regarding GIPR function, particularly regarding its role in proliferation versus tumor suppression. Researchers can employ several methodological approaches to reconcile these contradictions:

Systematic analysis framework:

  • Context-dependent signaling evaluation:

    • Comprehensively characterize G-protein coupling profiles in different cell types

    • Measure multiple downstream signaling pathways simultaneously

    • Compare acute versus chronic receptor activation outcomes

    Studies have shown that while the GIP/GIPR axis can exert pro-proliferative and anti-apoptotic effects in some contexts , GIPR overexpression in retinoblastoma cells demonstrates clear tumor suppressor properties .

  • Receptor expression level considerations:

    • Quantify receptor surface density across experimental models

    • Establish dose-response relationships at varying receptor densities

    • Consider physiological versus supraphysiological expression levels

  • Experimental design standardization:

    • Create a standardized panel of functional assays

    • Apply consistent protocols across cell types and models

    • Evaluate effects at multiple time points to capture temporal dynamics

  • Mechanistic reconciliation approaches:

    Experimental ContextObserved EffectPotential Mechanistic Explanation
    Pancreatic β-cellsProliferative, anti-apoptoticPredominant Gαs coupling, cAMP-dependent PKA and Epac2 activation
    Retinoblastoma cellsAnti-proliferative, pro-apoptoticp53 pathway activation, potential signaling bias
    Adipose tissueLipogenicInsulin-sensitizing effects, enhanced glucose uptake
    Neuronal cellsVariedCell type-specific effector availability
  • Genetic background assessment:

    • Compare effects in multiple cell lines of the same tissue

    • Consider the impact of mutations in downstream signaling components

    • Evaluate species-specific differences in signaling networks

  • Data integration strategies:

    • Meta-analysis of published findings with standardized effect size reporting

    • Multi-omics approaches to comprehensively profile cellular responses

    • Mathematical modeling of receptor signaling networks

By systematically addressing these factors, researchers can develop a unified model of GIPR function that accounts for the apparent contradictions, recognizing that G protein-coupled receptors frequently exhibit context-dependent signaling properties.

What emerging technologies and approaches could advance our understanding of Mesocricetus auratus GIPR function?

Several cutting-edge technologies offer promising avenues to deepen our understanding of GIPR biology in Mesocricetus auratus models:

Advanced structural biology approaches:

  • Cryo-EM for membrane protein complexes: Determine the 3D structure of hamster GIPR in various activation states and in complex with different ligands

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map conformational changes upon ligand binding

  • Single-particle tracking: Visualize receptor dynamics in live cells with nanometer precision

Genetic engineering technologies:

  • CRISPR-Cas9 genomic engineering:

    • Generate knock-in models with fluorescently tagged endogenous GIPR

    • Create precise point mutations to study structure-function relationships

    • Develop hamster models with humanized GIPR for translational studies

  • Conditional expression systems:

    • Tissue-specific and temporally controlled GIPR expression

    • Inducible miR-542-5p expression to modulate GIPR levels

Advanced 'omics and systems biology:

  • Spatial transcriptomics: Map GIPR expression patterns with subcellular resolution

  • Phosphoproteomics: Comprehensively profile signaling cascades activated by GIPR

  • Interactomics: Identify the complete GIPR interactome using proximity labeling approaches

  • Single-cell multi-omics: Characterize cell-specific responses to GIPR activation

Novel functional assessment technologies:

  • Biosensor development:

    • FRET-based sensors for real-time monitoring of GIPR conformational changes

    • Genetically encoded calcium indicators to measure GIPR-mediated calcium flux

    • cAMP biosensors for spatiotemporal signaling analysis

  • Organoid and microphysiological systems:

    • Develop hamster-derived organoids to study GIPR function in complex tissue architecture

    • Engineer organ-on-chip systems to evaluate multi-tissue effects of GIPR activation

  • In vivo imaging approaches:

    • PET imaging with radiolabeled GIPR ligands

    • Intravital microscopy to visualize receptor dynamics in living tissues

Computational and AI-driven approaches:

  • Molecular dynamics simulations: Model GIPR-ligand interactions and conformational changes

  • Machine learning for signaling pattern recognition: Identify complex relationships between GIPR activation and downstream effects

  • Network pharmacology: Predict and test combination approaches targeting GIPR signaling networks

These emerging technologies, when applied to Mesocricetus auratus GIPR research, hold tremendous potential to resolve current knowledge gaps and advance therapeutic applications in both metabolic disease and cancer.

What is the translational potential of Mesocricetus auratus GIPR research for human disease applications?

The translational potential of Mesocricetus auratus GIPR research spans multiple therapeutic areas with several promising applications:

Oncology applications:

  • Tumor suppression strategies: The identification of GIPR as a tumor suppressor in retinoblastoma suggests potential for:

    • Development of GIPR agonists as adjuvant therapy

    • Gene therapy approaches to increase GIPR expression in tumors

    • Combination therapies targeting GIPR and p53 pathways

  • Biomarker development:

    • GIPR expression profiling for cancer classification

    • Correlation with TFF1 expression for prognostic applications

    • Liquid biopsy approaches to detect GIPR-expressing circulating tumor cells

Metabolic disease applications:

  • Dual receptor targeting: Building on findings that dual GLP1R/GIPR agonists like MAR709 produce enhanced weight loss and glycemic improvements :

    • Optimization of balanced receptor activation

    • Development of long-acting formulations

    • Personalized medicine approaches based on receptor polymorphisms

  • Tissue-selective targeting:

    • Design of biased agonists that preferentially activate beneficial pathways

    • Adipose-targeted delivery systems to enhance local GIPR activation

    • Brain-penetrant GIPR modulators for central regulation of metabolism

Translational research framework:

Research StageHamster Model ContributionTranslation to Human Applications
Target validationDemonstrated GIPR tumor suppressor function Potential new therapeutic target for RB
PharmacologyEstablished EC50 values for dual agonists Dose prediction for human clinical trials
Efficacy modelsWeight loss and glycemic improvements in obesity models Expected outcomes in human metabolic disease
Safety assessmentIdentification of on-target effectsPrediction of adverse event profile
Biomarker developmentGIPR/TFF1 co-expression patterns Diagnostic and prognostic applications

Challenges in translation:

  • Species differences: Despite high homology, functionally relevant differences exist between hamster and human GIPR

  • Disease model limitations: Some human conditions may not be fully recapitulated in hamster models

  • Pharmacokinetic considerations: Drug metabolism and distribution may differ significantly

Accelerating translation:

  • Parallel studies in hamster and human cells/tissues

  • Development of humanized hamster models

  • Early-stage comparative pharmacology studies

  • Collaborative approaches between basic scientists and clinicians

The dual role of GIPR in metabolism and cancer provides a unique opportunity for translational research with potential applications across multiple disease areas. The hamster model offers valuable insights, particularly for initial proof-of-concept studies and mechanism elucidation, which can guide subsequent human-focused research.

What are the optimal protocols for cloning and expressing functional Mesocricetus auratus GIPR for research applications?

The following comprehensive protocol outlines the optimal approach for cloning and expressing functional Mesocricetus auratus GIPR:

1. Gene synthesis and vector design:

Materials:

  • Codon-optimized Mesocricetus auratus GIPR sequence (GenBank/UniProt accession)

  • Expression vector with strong promoter (pCDNA3.1, pLenti, etc.)

  • Selection marker appropriate for host cells

  • Epitope tag (His6, FLAG, or HA) for detection/purification

Protocol:

  • Design gene synthesis with flanking restriction sites

  • Include Kozak sequence (GCCACCATGG) before start codon

  • Consider adding N-terminal signal sequence for improved membrane targeting

  • Incorporate C-terminal epitope tag with flexible linker

  • Verify sequence integrity after cloning via full sequencing

2. Mammalian cell transfection and stable line generation:

Materials:

  • HEK293 or CHO cells (recommended host cells)

  • Transfection reagent (Lipofectamine 3000 or PEI)

  • Selection antibiotic (determined by vector)

  • Complete growth media with FBS

Protocol:

  • Seed cells at 70-80% confluence in 6-well plates

  • Transfect using optimized reagent:DNA ratio (typically 3:1)

  • Allow 24-48 hours for expression

  • Begin selection with appropriate antibiotic

  • Isolate single cell-derived colonies using cloning rings

  • Screen colonies for expression by western blot

  • Verify surface localization via immunofluorescence

  • Functional validation via cAMP accumulation assay

3. Lentiviral GIPR expression system (for difficult-to-transfect cells):

This approach has been successfully used for stable GIPR expression in retinoblastoma cell lines .

Materials:

  • Lentiviral transfer vector containing GIPR

  • Packaging plasmids (psPAX2, pMD2.G)

  • HEK293T cells for virus production

  • Target cells (e.g., WERI-Rb1 and Y79 retinoblastoma cells)

Protocol:

  • Co-transfect transfer vector with packaging plasmids into HEK293T

  • Collect viral supernatant at 48 and 72 hours

  • Filter through 0.45 μm filter

  • Transduce target cells with viral supernatant plus polybrene (8 μg/mL)

  • Select stable integrants with appropriate antibiotic

  • Validate expression via qRT-PCR and western blot

  • Confirm functionality through cell viability assays

4. Receptor functional validation:

Materials:

  • cAMP detection kit (ELISA or FRET-based)

  • GIP peptide ligand

  • GIPR inhibitor MK0893 (for specificity control)

  • Calcium indicator dyes (Fluo-4 AM)

Protocol:

  • Seed cells in appropriate assay plates

  • Serum-starve cells for 4 hours before assay

  • Treat with GIP dose series (10^-12 to 10^-6 M)

  • Measure cAMP accumulation after 30 minutes

  • Calculate EC50 values

  • Confirm specificity using MK0893 inhibitor

  • Assess calcium mobilization as secondary readout

For research applications requiring larger amounts of purified receptor protein, membrane preparation followed by detergent solubilization and affinity purification can be employed, with storage in Tris-based buffer containing 50% glycerol at -20°C for extended stability .

What experimental design considerations are critical for studying GIPR in various Mesocricetus auratus disease models?

When designing experiments to study GIPR in hamster disease models, several critical factors must be considered to ensure robust and translatable results:

1. Model selection and characterization:

Cancer models:

  • Cell line selection: For retinoblastoma studies, both WERI-Rb1 and Y79 cell lines have been validated for GIPR overexpression studies

  • Xenograft approaches: CAM assays provide rapid tumor formation assessment for GIPR-modified cells

  • Baseline characterization: Quantify endogenous GIPR and TFF1 expression before manipulation

Metabolic disease models:

  • Diet-induced obesity: Standardize high-fat diet composition (45-60% calories from fat) and duration (typically 12-16 weeks)

  • Genetic models: Consider available diabetic hamster models

  • Baseline phenotyping: Comprehensive metabolic characterization before intervention

2. Intervention design:

Genetic manipulations:

  • Overexpression approaches: Lentiviral vector systems have shown success for stable GIPR expression

  • Knockdown/knockout: siRNA, shRNA, or CRISPR-Cas9 approaches with validated hamster-specific targeting sequences

  • Control selection: Empty vector controls and scrambled RNA controls are essential

Pharmacological interventions:

  • Dosing considerations: Establish full dose-response relationships

  • Proper controls: Include vehicle control and positive control groups

  • Route of administration: Consider pharmacokinetic differences between routes

  • Timing of intervention: Both prevention (before disease onset) and treatment (after disease establishment) protocols

3. Endpoint selection and assessment:

Cancer endpoints:

  • Cell viability/growth: MTT/WST-1 assays, colony formation assays

  • Apoptosis quantification: Flow cytometry with Annexin V/PI, TUNEL assay

  • Tumor size measurement: Standardized caliper measurements or imaging techniques

  • Molecular analysis: Proteome profiler oncology arrays for pathway activation

Metabolic endpoints:

  • Glycemic control: Fasting glucose, insulin, GTT, ITT

  • Body composition: DEXA or NMR for fat/lean mass determination

  • Energy balance: Food intake, indirect calorimetry for energy expenditure

  • Tissue analysis: Islet morphology, adipose tissue inflammation, hepatic steatosis

4. Statistical design considerations:

  • Sample size calculation: Based on expected effect size from preliminary data

  • Randomization: Proper randomization to experimental groups

  • Blinding: Blind assessment of outcomes when possible

  • Multiple testing correction: Appropriate statistical approaches for multiple endpoints

5. Translational considerations:

  • Comparative pharmacology: Include parallel human cell experiments when possible

  • Biomarker development: Identify potential translational biomarkers (e.g., GIPR/TFF1 co-expression)

  • PK/PD relationships: Establish exposure-response relationships for pharmacological interventions

Example experimental design matrix for GIPR tumor suppressor evaluation:

Experimental GroupGenetic ManipulationPharmacological TreatmentKey EndpointsExpected Outcome
ControlEmpty vectorVehicleTumor growth, apoptosisBaseline growth
GIPR overexpressionLentiviral GIPRVehicleTumor growth, apoptosisReduced growth, increased apoptosis
GIPR inhibitionGIPR overexpressionMK0893Tumor growth, apoptosisReversal of GIPR effects
Pathway analysisGIPR overexpressionp53 inhibitorSignaling activationIdentification of dependency on p53

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.