Recombinant Mesocricetus auratus Inward rectifier potassium channel 4 (KCNJ4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mesocricetus auratus Inward Rectifier Potassium Channel 4 (KCNJ4)

The Inward Rectifier Potassium Channel 4 (KCNJ4), also referred to as K~ir~2.3, belongs to the inwardly rectifying K+ channel family . These channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it, a feature regulated by the concentration of extracellular potassium . The KCNJ4 gene encodes this protein, which functions as an integral membrane protein crucial for electrical signaling in the nervous system and the excitability of muscle cells .

Basic Information of KCNJ4
Protein Name
Gene Name
Aliases
Organism
UniProt ID
Transmembrane Times
Length (aa)

Function of KCNJ4

KCNJ4 plays important roles in several physiological processes :

  • Regulation of Resting Membrane Potential: KCNJ4 contributes to maintaining the resting membrane potential in various cells, including neurons, glial cells, and myocytes .

  • Cellular Excitability: By influencing potassium homeostasis, KCNJ4 affects the excitability of cells in both the nervous system and peripheral tissues .

  • Potassium Homeostasis: KCNJ4 is vital for maintaining potassium balance in the nervous system and other tissues .

  • Cardiac Function: In neonatal rat cardiomyocytes, KCNJ4 participates in the cardiac classical inward rectifier potassium currents (I K1), which stabilize the resting membrane potential, determine excitation threshold, and initiate the final repolarization phase of the cardiac action potential .

  • Neurotransmission and Cell Communication: KCNJ4 channels can directly couple to G proteins, enabling their involvement in neurotransmission and cell-cell communications .

Distribution and Localization

The distribution of KCNJ4 is prominent in the heart and brain, especially in cardiac myocytes and the forebrain region . In the nervous system, neuronal KCNJ4 is found diffusely in the nuclei and on the plasma membrane of pyramidal cells in the CA3 region of the hippocampus, an area associated with cognition, memory, emotion, and neuropsychiatric disorders . KCNJ4 is mainly localized at the postsynaptic membrane of excitatory synapses .

Interactions of KCNJ4

KCNJ4 interacts with several proteins, which include :

  • CASK

  • DLG1

  • DLG4

  • LIN7B

  • LIN7C

KCNJ4 and Disease

Mutations or malfunctions in KCNJ4 have been linked to various diseases:

  • EAST/SeSAME Syndrome: Loss-of-function mutations in KCNJ10, which encodes the Kir4.1 channel, lead to EAST/SeSAME syndrome, characterized by epilepsy, ataxia, renal salt wasting, and sensorineural deafness .

  • Cancer Progression: KCNJ4 has been linked with cancer progression and might be a valuable prognostic biomarker and potential therapeutic target for cancers .

  • Mycotoxin-Induced Damage: Increasing potassium channel levels, including KCNJ4, may be a putative therapeutic target for mycotoxin-induced damage. AAV-KCNJ4 delivery significantly improved ZEA-induced renal impairment and increased antioxidative enzyme activity by improving mitochondrial function .

  • Polymyxin-Induced Nephrotoxicity: Inwardly rectifying potassium channels, including Kir4.2 and Kir5.1, mediate polymyxin-induced nephrotoxicity. Inhibitors of Kir potassium channels reduced polymyxin-induced toxicity in cell culture and mouse explant kidney tissue .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCNJ4; IRK3; Inward rectifier potassium channel 4; Inward rectifier K(+ channel Kir2.3; IRK-3; Potassium channel, inwardly rectifying subfamily J member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Mesocricetus auratus (Golden hamster)
Target Names
KCNJ4
Target Protein Sequence
MHGHNRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM LFSAAFLVSWLFFGLLFWCIAFFHGDLEASPSVPAAGAPGGNGGAAPAAPKPCIMHVNGF LGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKR AQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRD LNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTT QARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVL PAPPPPRSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGPKEEAGIIRMLEFGS HLDLERMQGTLPLDNISYRRESAI
Uniprot No.

Target Background

Function

Inward rectifier potassium channels are characterized by a preferential influx of potassium ions. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel activation voltage to more positive potentials. Inward rectification is primarily attributed to intracellular magnesium block of outward potassium currents.

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ4 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is the KCNJ4 protein and what are its alternative names in scientific literature?

KCNJ4 (potassium inwardly-rectifying channel, subfamily J, member 4) is an integral membrane protein and member of the inward rectifier potassium channel family. In scientific literature, KCNJ4 is also known as HIR, hIRK2, HRK1, IRK3, and Kir2.3 (inward rectifier K+ channel Kir2.3), as well as hippocampal inward rectifier potassium channel . The protein has a relatively small unitary conductance compared to other members of this protein family and exists in two transcript variants, both encoding the identical protein .

How does KCNJ4 function differ from other inward rectifier potassium channels?

KCNJ4 (Kir2.3) belongs to the classical Kir channels group and has distinct functional characteristics. Unlike voltage-gated potassium channels, KCNJ4 shows greater tendency to allow potassium to flow into the cell rather than out of it, which is characteristic of inward rectifier channels . This asymmetry in potassium ion conductance is crucial for regulating excitability in muscle cells and neurons . Compared to other members of the inward rectifier family, KCNJ4 exhibits notably smaller unitary conductance, making it functionally distinct in electrophysiological studies . This unique property affects its role in fine-tuning membrane potentials compared to higher-conductance inward rectifiers.

What are the recommended storage conditions for recombinant Mesocricetus auratus KCNJ4 protein?

Based on related inward rectifier potassium channel proteins from Mesocricetus auratus, the recommended storage conditions for recombinant KCNJ4 are as follows: The protein should be stored in a Tris-based buffer with approximately 50% glycerol optimized for protein stability . For short-term storage, maintain working aliquots at 4°C for up to one week . For extended storage, the protein should be kept at -20°C, and for long-term preservation, -80°C is recommended . It is important to note that repeated freezing and thawing cycles should be avoided to maintain protein integrity and function .

What biochemical functions are associated with KCNJ4?

KCNJ4 exhibits several key biochemical functions important in cellular physiology:

  • Inward rectifier potassium channel activity: KCNJ4 primarily functions as an ion channel that selectively conducts potassium ions inward at membrane potentials negative to the equilibrium potential for potassium .

  • PDZ domain binding: KCNJ4 can interact with proteins containing PDZ domains, which is crucial for proper localization, clustering, and regulation of the channel in specific cellular compartments .

  • Protein binding: KCNJ4 engages in various protein-protein interactions that modulate its function, trafficking, and involvement in signaling cascades .

These biochemical properties enable KCNJ4 to participate in complex cellular processes, particularly in excitable tissues like neurons where precise control of membrane potential is critical.

What are the recommended protocols for isolating functional KCNJ4 from Mesocricetus auratus tissues?

For isolating functional KCNJ4 from Mesocricetus auratus tissues, researchers should employ the following methodology adapted from established protocols for similar potassium channels:

  • Tissue preparation: Remove the target tissue (most commonly brain or cardiac tissue) from the animal and immediately place in ice-cold Ca²⁺-free Hank's solution containing (in mM): 125 NaCl, 5.36 KCl, 15.5 NaHCO₃, 0.336 Na₂HPO₄, 0.44 K₂HPO₄, 10 glucose, 2.9 sucrose, and 11 Hepes (pH adjusted to 7.2 with NaOH) .

  • Enzymatic dissociation: Cut tissue into small pieces and incubate at 37°C in Ca²⁺-free Hank's solution containing collagenase type II (5 mg/mL), bovine serum albumin (8 mg/mL), trypsin inhibitor (8 mg/mL), papain (0.04 mg/mL), and L-dithiothreitol (0.04 mg/mL) for 25-50 minutes depending on tissue density .

  • Cell recovery: After enzymatic treatment, gently triturate the tissue to release individual cells. Place the cell suspension in Ca²⁺-free solution at 4°C before further processing .

  • Cell purification: For pure populations of cells expressing KCNJ4, fluorescence-activated cell sorting (FACS) can be employed using appropriate cell-type specific markers or by using transgenic animals expressing fluorescent proteins in specific cell types .

This isolation protocol preserves the functional integrity of ion channels, making the cells suitable for subsequent electrophysiological recordings or protein extraction.

What experimental approaches are most effective for studying KCNJ4 electrophysiological properties?

Several experimental approaches are particularly effective for studying the electrophysiological properties of KCNJ4 channels:

  • Patch-clamp recordings: The gold standard for direct measurement of ion channel activity.

    • Whole-cell configuration allows measurement of total KCNJ4 currents across the entire cell membrane

    • Single-channel recordings provide insights into individual channel conductance and gating kinetics

    • Cell-attached patches enable study of channel activity in a native membrane environment

  • Two-electrode voltage clamp: Particularly useful for expression systems like Xenopus oocytes when studying recombinant KCNJ4.

  • Voltage-sensitive dyes: Provide a less invasive approach to measure membrane potential changes mediated by KCNJ4 activity in cell populations.

  • Heterologous expression systems: Expression of recombinant KCNJ4 in cell lines (HEK293, CHO) allows for controlled experimental conditions and the study of mutant channels .

  • Current-clamp experiments: Essential for understanding how KCNJ4 activity influences action potential properties and neuronal excitability.

Each approach has specific advantages depending on the research question, with patch-clamp techniques offering the highest resolution for detailed biophysical characterization.

How can researchers efficiently purify recombinant KCNJ4 protein for functional studies?

Efficient purification of recombinant KCNJ4 protein requires a systematic approach:

  • Expression system selection: Mammalian expression systems (HEK293) are preferred for maintaining proper post-translational modifications and folding, though E. coli systems may be used for structural domains .

  • Affinity tag incorporation: During the production process, incorporate an appropriate affinity tag (His, FLAG, or GST) to facilitate purification while minimizing interference with channel function .

  • Solubilization: Carefully extract the membrane-bound KCNJ4 using mild detergents (such as DDM, LMNG, or digitonin) that preserve protein structure and function.

  • Column chromatography: Perform affinity chromatography using the incorporated tag, followed by size exclusion chromatography to obtain homogeneous protein preparations.

  • Quality assessment: Verify protein purity using SDS-PAGE and Western blotting, and assess functional integrity through reconstitution in lipid bilayers or proteoliposomes for electrophysiological recordings.

  • Storage optimization: Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for routine use or -80°C for long-term storage .

For functional studies requiring native-like environments, reconstitution into nanodiscs or liposomes is recommended to maintain the channel in a lipid bilayer context.

How does KCNJ4 interact with other proteins in signaling pathways?

KCNJ4 participates in complex protein interaction networks that modulate its function and integrate it into broader signaling pathways:

  • PDZ domain interactions: KCNJ4 interacts with several PDZ domain-containing proteins, including:

    • Dlg1 (Discs large homolog 1): Involved in channel clustering and localization

    • LIN7B and Lin7c: Scaffolding proteins that help anchor KCNJ4 to specific membrane domains

    • Cask: A calcium/calmodulin-dependent serine protein kinase that may regulate channel activity

  • Pathway integration: KCNJ4 functions within several important signaling pathways:

    • GABA receptor signaling: Participates in inhibitory neurotransmission pathways

    • G-protein coupled receptor pathways: Functions downstream of G-protein activation

    • Cholinergic signaling: Contributes to acetylcholine-mediated responses

  • Regulatory interactions: KCNJ4 activity is modulated by:

    • Direct binding of PIP₂ (phosphatidylinositol 4,5-bisphosphate)

    • Phosphorylation by protein kinases

    • Interactions with G-protein subunits

These interactions allow KCNJ4 to serve as an integration point for multiple cellular signals, particularly in neurons where precise control of excitability is essential for proper function.

What are the emerging roles of KCNJ4 and related inward rectifier potassium channels in neuropsychiatric disorders?

Recent research has revealed important connections between inward rectifier potassium channels like KCNJ4 and neuropsychiatric conditions:

  • Depression: Several potassium channel gene variants have been associated with depression vulnerability and treatment response. While specific KCNJ4 associations haven't been definitively established, the related channel KCNK2 shows significant associations with depression, with several SNPs (rs6686529, rs7549184, rs10779646) showing higher homozygote rates in depression patients compared to controls .

  • Treatment responses: Genetic variants in potassium channels can predict antidepressant efficacy, as observed with KCNK2 variants rs12136349 and rs2841616 .

  • Neural excitability: As regulators of membrane potential, inward rectifier channels like KCNJ4 influence neural excitability in brain regions associated with emotion processing.

  • Therapeutic targets: The involvement of potassium channels in depression makes them potential targets for novel therapeutic approaches, with KCNJ4 modulators representing an unexplored avenue for neuropsychiatric drug development.

  • Comorbid conditions: KCNJ4 dysfunction may contribute to cognitive impairments often comorbid with mood disorders, given its expression in hippocampal regions critical for learning and memory.

These emerging roles highlight the importance of understanding KCNJ4 function in both normal physiology and pathological conditions, suggesting new directions for neuropsychiatric research.

What methodological approaches are best for studying KCNJ4 function in native tissues versus heterologous expression systems?

Studying KCNJ4 function requires different methodological approaches depending on whether the research focuses on native tissues or heterologous expression systems:

In Native Tissues:

In Heterologous Expression Systems:

  • Expression optimization: Select appropriate vectors and cell lines (HEK293, CHO, or Xenopus oocytes) for optimal KCNJ4 expression .

  • Mutagenesis studies: Create specific channel mutations to study structure-function relationships.

  • Biophysical characterization: Perform detailed electrophysiological recordings under controlled conditions to determine fundamental channel properties.

  • Fluorescent tagging: Incorporate fluorescent proteins to track channel trafficking and membrane localization.

  • Drug screening: Utilize high-throughput approaches to identify novel KCNJ4 modulators.

Each approach offers distinct advantages: native tissues provide physiological relevance while heterologous systems offer experimental control and manipulation possibilities.

How can KCNJ4 channels be targeted for potential therapeutic applications?

Targeting KCNJ4 channels for therapeutic applications requires several strategic approaches:

  • Small molecule modulators: Development of compounds that can:

    • Enhance KCNJ4 activity to increase membrane hyperpolarization (potentially useful in hyperexcitability disorders)

    • Inhibit KCNJ4 function to promote depolarization (potentially valuable in conditions requiring increased cellular activity)

    • Allosterically modulate channel gating without completely blocking ion permeation

  • Pathway-based interventions: Target regulatory pathways involving:

    • G-protein coupled receptors that modulate KCNJ4 activity

    • Enzymes controlling phosphorylation/dephosphorylation of the channel

    • PIP₂ metabolism, which affects channel gating

  • Gene therapy approaches:

    • Viral vector-mediated delivery of functional KCNJ4 to compensate for dysfunctional channels

    • RNA interference to downregulate excessive channel expression

    • CRISPR-based gene editing to correct pathogenic mutations

  • Protein-protein interaction targeting:

    • Develop peptides or small molecules that disrupt interactions with specific partners like Dlg1, LIN7B, and Cask

    • Engineer scaffold proteins to enhance or redirect channel localization

These therapeutic strategies could be applied to neurological conditions like epilepsy, psychiatric disorders like depression , and cardiac arrhythmias where potassium channel function is implicated.

How does KCNJ4 from Mesocricetus auratus compare with orthologs from other species?

Comparative analysis of KCNJ4 across species reveals important evolutionary conservation and divergence:

  • Sequence homology: Mesocricetus auratus KCNJ4 shares significant sequence identity with orthologs from:

    • Human (approximately 90-95% identity)

    • Rat and mouse (approximately 95-98% identity)

    • Other mammalian species (generally >85% identity)

  • Functional domains: Key structural elements are highly conserved across species:

    • Transmembrane domains and pore region show highest conservation

    • Cytoplasmic domains exhibit more variability, particularly in regulatory regions

    • PIP₂ binding sites maintain strong evolutionary conservation

  • Physiological roles: Despite sequence variations, the fundamental channel properties remain similar across species, reflecting the essential role of inward rectification in cellular physiology.

  • Expression patterns: Species differences in tissue-specific expression patterns may reflect adaptations to specific physiological demands.

  • Pharmacological responses: Sensitivity to blockers like barium and cesium is generally conserved, though subtle species differences in drug sensitivity may exist.

These comparative insights are valuable for translating research findings across species and for understanding the evolutionary significance of KCNJ4 structure-function relationships.

What are the major challenges in studying KCNJ4 function in complex neural circuits?

Researchers face several significant challenges when investigating KCNJ4 function within complex neural circuits:

  • Cell-type specificity: KCNJ4 is expressed in various neuronal populations, making it difficult to isolate channel function in specific cell types. Advanced approaches using cell-type-specific promoters for targeted expression or Cre-dependent knockout are necessary .

  • Subcellular localization: KCNJ4 may have different functions depending on its localization (somatic, dendritic, or axonal), requiring high-resolution imaging techniques and compartment-specific electrophysiology.

  • Functional redundancy: Other inward rectifier channels (KCNJ2, KCNJ3, etc.) may compensate for KCNJ4 manipulation, necessitating careful pharmacological dissection or multiple-channel knockout approaches.

  • Network effects: Altering KCNJ4 function in one neuronal population affects the broader circuit, creating complexity in interpreting experimental results.

  • Temporal dynamics: KCNJ4 expression and function may change during development or in response to activity, requiring temporally controlled manipulation techniques.

  • Translation to behavior: Connecting channel-level observations to behavioral outcomes requires sophisticated in vivo approaches that preserve circuit integrity while allowing channel manipulation.

Addressing these challenges requires integrating molecular techniques, electrophysiology, imaging, and behavioral methods with computational modeling to understand KCNJ4's role in neural circuit function.

What key experimental controls should be implemented when studying KCNJ4 in different expression systems?

When studying KCNJ4 in expression systems, implementing proper controls is essential for obtaining reliable and interpretable results:

  • Expression verification controls:

    • Western blotting to confirm protein expression levels

    • Immunocytochemistry to verify membrane localization

    • qPCR to quantify mRNA expression levels

    • Non-transfected cells as negative controls

  • Functional validation controls:

    • Known KCNJ4 blockers (barium, cesium) to confirm channel identity

    • Manipulation of extracellular potassium to verify potassium selectivity

    • Expression of related channels (KCNJ2, KCNJ3) for comparative analysis

    • Use of dominant-negative constructs as functional controls

  • System-specific controls:

    • For mammalian cells: Empty vector transfections to control for transfection effects

    • For Xenopus oocytes: Water-injected oocytes as negative controls

    • For primary cultures: Genetic knockout or knockdown validation

  • Interaction studies controls:

    • GST-only or His-only pulldowns for protein interaction studies

    • Mutated binding motifs to confirm specificity of protein-protein interactions

    • Competition assays with peptides mimicking interaction domains

  • Pharmacological controls:

    • Dose-response curves for all modulators

    • Vehicle controls for drug studies

    • Time-matched controls to account for channel rundown

These controls ensure that observed effects can be specifically attributed to KCNJ4 function rather than experimental artifacts or non-specific effects.

What emerging technologies could advance our understanding of KCNJ4 structure-function relationships?

Several cutting-edge technologies hold promise for deepening our understanding of KCNJ4 structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM): This technique is revolutionizing membrane protein structural biology, potentially revealing:

    • High-resolution structures of KCNJ4 in different functional states

    • Conformational changes during gating

    • Interactions with regulatory proteins and lipids

  • Advanced electrophysiology:

    • Automated patch-clamp platforms for high-throughput functional screening

    • Optical electrophysiology using voltage-sensitive fluorescent proteins

    • In vivo patch-clamp recordings during behavior

  • Genetically-encoded biosensors:

    • FRET-based sensors to detect channel conformational changes in real-time

    • PIP₂ sensors to correlate lipid dynamics with channel function

    • Calcium indicators to link channel activity with downstream signaling

  • Gene editing technologies:

    • CRISPR-Cas9 for precise modification of KCNJ4 in native tissues

    • Base editing for introducing specific mutations

    • Prime editing for more complex genetic modifications

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational dynamics

    • Super-resolution microscopy to visualize channel clustering and trafficking

    • Atomic force microscopy to measure structural changes during channel gating

These technologies, particularly when used in combination, will provide unprecedented insights into how KCNJ4 structure relates to its physiological functions and disease associations.

How might KCNJ4 research inform the development of novel neuropsychiatric treatments?

KCNJ4 research has significant potential to inform novel neuropsychiatric treatment strategies:

  • Targeted pharmacology: Understanding KCNJ4's role in neural excitability could lead to development of:

    • Subtype-specific potassium channel modulators with fewer side effects

    • Allosteric modulators that fine-tune rather than block channel function

    • Compounds that target specific KCNJ4-containing channel assemblies

  • Biomarker identification: KCNJ4 variants or expression patterns may serve as:

    • Predictors of treatment response, similar to findings with related potassium channels like KCNK2

    • Diagnostic markers for specific neuropsychiatric subtypes

    • Targets for personalized medicine approaches

  • Circuit-based interventions: Knowledge of KCNJ4's role in neural circuits could inform:

    • Targeted neuromodulation therapies (TMS, tDCS)

    • Circuit-specific drug delivery systems

    • Combined pharmacological and neurostimulation approaches

  • Novel therapeutic targets: Beyond direct channel targeting, research may reveal:

    • Regulatory proteins that modulate KCNJ4 function as druggable targets

    • Pathway-based interventions that normalize channel function

    • Gene therapy approaches for disorders with KCNJ4 dysfunction

  • Comorbidity treatment: Understanding KCNJ4's role in both mood regulation and cognition could lead to treatments addressing both depression symptoms and cognitive impairments .

The connection between potassium channel function and depression, as evidenced by studies of related channels, suggests KCNJ4 modulation could represent an untapped approach to treating mood disorders with potentially fewer side effects than current options.

What are common troubleshooting strategies for recombinant KCNJ4 expression and functional studies?

Researchers frequently encounter technical challenges when working with recombinant KCNJ4. Here are effective troubleshooting strategies:

  • Low protein expression:

    • Optimize codon usage for the expression system

    • Try different promoters (CMV, EF1α)

    • Adjust transfection conditions (reagent, DNA:lipid ratio)

    • Consider stable cell lines for consistent expression

    • Test different tags that may improve protein stability

  • Mislocalization:

    • Verify targeting sequences are intact

    • Co-express trafficking partners such as Dlg1, LIN7B, or Cask

    • Optimize cell culture conditions (temperature, confluency)

    • Use trafficking enhancers like glycerol or DMSO

    • Consider fusion to fluorescent proteins to monitor localization

  • Lack of functional activity:

    • Ensure recording solutions match physiological requirements

    • Verify expression of necessary auxiliary subunits

    • Check for inhibitory post-translational modifications

    • Optimize membrane composition, particularly PIP₂ levels

    • Consider lower expression temperature (30°C instead of 37°C)

  • Protein degradation:

    • Include protease inhibitors during purification

    • Optimize storage buffer composition (50% glycerol, reducing agents)

    • Avoid repeated freeze-thaw cycles

    • Consider fusion partners that enhance stability

  • Non-specific interactions:

    • Increase stringency in washing steps during co-immunoprecipitation

    • Use appropriate controls for binding studies

    • Implement crosslinking controls to verify direct interactions

    • Perform competition assays with peptides

These troubleshooting approaches address the most common technical challenges in KCNJ4 research, enhancing experimental success rates.

How can researchers effectively distinguish between different potassium channel subtypes in native tissues?

Distinguishing between potassium channel subtypes in native tissues requires a multifaceted approach:

  • Pharmacological profiling:

    • Use subtype-selective blockers with known specificity profiles

    • Implement concentration-response relationships to identify channel subtypes

    • Apply sequential blocker application to dissect mixed currents

    • Utilize activators with subtype selectivity when available

  • Biophysical characterization:

    • Analyze conductance properties (KCNJ4 has smaller conductance than many related channels)

    • Examine inward rectification characteristics (strength, voltage-dependence)

    • Measure kinetic properties (activation, deactivation, inactivation)

    • Determine ion selectivity profiles

  • Molecular approaches:

    • Perform single-cell RT-PCR after electrophysiological recording

    • Use subtype-specific antibodies for immunolabeling

    • Implement RNA interference with subtype-selective siRNAs

    • Apply CRISPR-Cas9 to knock out specific channel genes

  • Cell isolation strategies:

    • Use FACS to isolate specific cell populations

    • Employ transgenic animals with fluorescently labeled cell types

    • Implement laser capture microdissection for regional analysis

  • Computational methods:

    • Apply mathematical modeling to decompose complex current recordings

    • Use machine learning algorithms to identify channel signatures in mixed recordings

    • Implement Markov modeling to distinguish gating characteristics

Combining these approaches provides a robust strategy for distinguishing KCNJ4 from other potassium channel subtypes in complex native tissues.

What are the recommended learning pathways for new researchers entering the KCNJ4 field?

For researchers new to KCNJ4 and inward rectifier potassium channels, the following structured learning pathway is recommended:

  • Foundational knowledge:

    • Begin with basic ion channel biophysics and electrophysiology principles

    • Study potassium channel diversity and classification systems

    • Master membrane potential concepts and the role of potassium channels

    • Understand the unique properties of inward rectification

  • Technical training sequence:

    • Start with basic molecular biology techniques (PCR, cloning, expression)

    • Progress to protein biochemistry methods (Western blotting, immunoprecipitation)

    • Learn cell culture and transfection techniques for heterologous expression

    • Advance to electrophysiological recordings (patch-clamp, voltage-clamp)

  • Specialized KCNJ4 knowledge:

    • Study KCNJ4's role in specific tissues and physiological processes

    • Examine its interactions with other proteins and signaling pathways

    • Investigate its involvement in pathophysiological conditions

    • Explore comparative aspects across species

  • Collaborative skill development:

    • Gain experience in multidisciplinary approaches

    • Learn to integrate molecular, cellular, and systems-level data

    • Develop computational skills for data analysis and modeling

    • Build expertise in translational aspects of channel research

  • Recommended resources:

    • Textbooks: "Ion Channels of Excitable Membranes" by Bertil Hille

    • Online courses: IUPHAR/BPS Guide to Pharmacology

    • Research techniques primers: Journal of Visualized Experiments (JoVE)

    • Professional societies: Biophysical Society, American Physiological Society

This structured approach ensures new researchers develop both breadth and depth in KCNJ4 research.

How can researchers validate their experimental approaches when studying KCNJ4?

Rigorous validation of experimental approaches is essential for reliable KCNJ4 research:

  • Molecular identity validation:

    • Sequence verification of all constructs

    • Expression confirmation using Western blotting and immunocytochemistry

    • Functional verification with known channel properties

    • Knockout/knockdown controls to confirm antibody specificity

  • Functional assay validation:

    • Calibration of electrophysiological equipment with known standards

    • Pharmacological verification using established channel blockers

    • Reversal potential measurements to confirm potassium selectivity

    • Comparison with published biophysical parameters

  • Experimental design validation:

    • Power analysis to determine appropriate sample sizes

    • Blinding procedures for subjective measurements

    • Randomization protocols to minimize bias

    • Inclusion of both positive and negative controls

  • Analytical approach validation:

    • Use of multiple analytical methods to confirm findings

    • Statistical validation appropriate to data distribution

    • Testing assumptions underlying analytical methods

    • Independent replication of key findings

  • Translational relevance validation:

    • Confirming findings across multiple experimental systems

    • Verifying relevance to native tissues

    • Establishing physiological significance of observed effects

    • Correlating molecular findings with cellular or behavioral outcomes

By implementing these validation strategies, researchers can ensure their KCNJ4 studies produce robust, reproducible, and meaningful results that advance understanding of this important potassium channel.

What are the most significant recent advances in KCNJ4 research and future priorities?

Recent advances in KCNJ4 research have expanded our understanding of this important potassium channel, with several key developments standing out:

  • Structural insights: Improved structural biology techniques have begun to reveal molecular details of inward rectifier channel gating and regulation, though KCNJ4-specific structures remain to be fully determined.

  • Functional characterization: Advanced electrophysiological approaches have refined our understanding of KCNJ4's biophysical properties and how they differ from related channels like KCNJ2 (Kir2.1) and KCNJ3 (Kir3.1) .

  • Interaction networks: Proteomic studies have identified key interacting partners including Dlg1, LIN7B, Cask, and Lin7c, expanding our understanding of how KCNJ4 is regulated and localized .

  • Signaling integration: Research has clarified KCNJ4's role in multiple signaling pathways, including GABA receptor activation, cholinergic signaling, and G-protein coupled pathways .

  • Pathophysiological relevance: Emerging evidence suggests potassium channels including KCNJ4 may play roles in neuropsychiatric conditions, opening new therapeutic avenues .

Future research priorities should focus on:

  • Developing KCNJ4-specific pharmacological tools

  • Clarifying its role in specific neural circuits

  • Determining its contribution to neuropsychiatric disorders

  • Understanding its dynamic regulation in health and disease

  • Exploring its potential as a therapeutic target

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.