Recombinant Mesocricetus auratus Potassium voltage-gated channel subfamily V member 1 (KCNV1)

Shipped with Ice Packs
In Stock

Description

Table 1: Comparison of Recombinant KCNV1 Products

FeatureCBM15 Product Antibodies-Online Product
SpeciesMesocricetus auratusHuman (cross-reactive studies)
Expression SystemUnspecifiedEscherichia coli
TagDetermined during productionHis-tag
ApplicationsELISACrystallization, Western blot, ELISA
Purity>95%>95%

Functional Role and Mechanisms

KCNV1 is an electrically silent subunit that modulates other Kv channels through heterotetrameric assembly:

  • Channel Modulation:

    • Shifts inactivation thresholds of KCNB1 (Kv2.1) and KCNB2 (Kv2.2) to more negative potentials, slowing inactivation kinetics .

    • Downregulates KCNB1, KCNB2, KCNC4 (Kv3.4), and KCND1 (Kv4.1) by trapping them intracellularly .

  • Biophysical Properties:

    • Lacks intrinsic channel activity but confers unique gating properties when coassembled with Kv2 subunits .

Research Applications

Recombinant KCNV1 is utilized in diverse experimental contexts:

  • Protein Interaction Studies: Investigating Kv2/KvS heterotetramer formation and trafficking .

  • Disease Modeling: Associated with neurological disorders (e.g., schizophrenia) and epilepsy due to its regulatory role in neuronal excitability .

  • Structural Biology: Crystallization assays to resolve Kv channel architecture .

Clinical and Therapeutic Relevance

  • Neurological Disorders: Common KCNV1 polymorphisms are linked to schizophrenia, suggesting a role in ion homeostasis imbalances .

  • Cardiac and Epithelial Dysfunction: While KCNV1 itself is not directly implicated, related Kv channels (e.g., KCNQ1) are critical in cardiac repolarization and epithelial transport .

Challenges and Future Directions

  • Species-Specific Data: Limited genomic resources for Mesocricetus auratus hinder comparative studies .

  • Mechanistic Insights: Further structural studies are needed to clarify how KCNV1’s FTL motif (Phe-Thr-Leu) allosterically modulates partner channels .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCNV1; Potassium voltage-gated channel subfamily V member 1; Voltage-gated potassium channel subunit Kv8.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-504
Protein Length
full length protein
Species
Mesocricetus auratus (Golden hamster)
Target Names
KCNV1
Target Protein Sequence
MDLSPRNRPLLESSSLDSGGSLSSLDSSVFCSEGEGEPLALGDCLTVNVGGSRFVLSQQA LSCFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSSQAFRYVLHY YRTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTDDQES QHESEQDFSQGPCPTVRQKLWDILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSW LNLQLLEILEYVCISWFTGEFILRFLCVKDRCRFLRKVPNIIDLLAILPFYITLLVESLS GSHTTQELENVGRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVG ISIFSTIEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSG ILVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSI MEMLRLKGRERASTRSSGGDDFWF
Uniprot No.

Target Background

Function

Potassium channel subunit incapable of forming functional channels independently. It modulates KCNB1 and KCNB2 channel activity by shifting the inactivation threshold to more negative potentials and slowing inactivation kinetics. It can downregulate the channel activity of KCNB1, KCNB2, KCNC4, and KCND1, potentially by retaining them within intracellular membranes.

Protein Families
Potassium channel family, V (TC 1.A.1.2) subfamily, Kv8.1/KCNV1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain, throughout layers II, IV and VI of the brain cortex. Detected in cerebellum and hippocampus, in the granule cell layer, Purkinje cell layer, pyramidal cell layer and dentate gyrus. Detected at lower levels in olfactory bulb, amygdala, t

Q&A

How does KCNV1 differ structurally from other potassium channel family members?

KCNV1 belongs to the 6-transmembrane (6-TM) family of potassium channels. While sharing structural similarities with other members of the KCNQ family (KCNQ1-5), there are important differences that contribute to its unique function:

  • Structural comparison: KCNV1, like other voltage-gated potassium channels, contains a single pore-forming region. The alpha-subunits combine to form tetramers .

  • Paralog conservation: Research on voltage-gated potassium channels shows varying degrees of conservation across the KCNQ family. Sites with high conservation across paralogs (KCNQ1-5) often relate to fundamental channel functions, while less conserved sites contribute to the unique functional properties that distinguish KCNV1 from its homologs .

  • Functional domains: Unlike some other potassium channels that can form functional homomeric channels, KCNV1 requires association with other subunits to modulate channel activity, suggesting structural differences in its assembly domains .

What are the optimal expression systems for recombinant KCNV1 production?

The choice of expression system depends on your research objectives:

Bacterial expression (E. coli):

  • Suitable for producing recombinant protein for structural studies, antibody production, and some functional assays

  • The commercially available recombinant KCNV1 is expressed in E. coli with an N-terminal His tag

  • Advantages: High yield, cost-effective, rapid production

  • Limitations: Lacks post-translational modifications, potential for improper folding of membrane proteins

Mammalian expression systems:

  • Recommended for functional electrophysiological studies

  • Advantages: Proper folding and post-translational modifications

  • Common cell lines: HEK293, CHO, VERO-ZAP-KO cells

  • Methodology: Transfection of overlapping DNA fragments has been successfully used for other ion channel proteins

Experimental protocol comparison:

Expression SystemProtein YieldFunctional ActivityPost-translational ModificationsRecommended Applications
E. coliHighLimitedAbsentStructural studies, antibody production
Mammalian cellsModerateHighPresentElectrophysiological studies, trafficking studies
Cell-free systemsModerateVariableDepends on systemRapid screening, protein-protein interaction studies

How can I validate the functional activity of recombinant KCNV1?

Since KCNV1 does not form functional channels by itself but modulates activity of other potassium channels, validation requires co-expression with its target channels:

Electrophysiological validation:

  • Co-express KCNV1 with known target channels (KCNB1, KCNB2) in a suitable expression system

  • Perform patch-clamp recordings to measure:

    • Shifts in the voltage dependence of activation

    • Changes in inactivation kinetics

    • Altered current amplitudes

Biochemical validation:

  • Co-immunoprecipitation with target channels to confirm physical interaction

  • Western blotting to assess expression levels and protein integrity

  • Trafficking assays to determine subcellular localization (particularly important since KCNV1 may trap other channels in intracellular membranes)

What methods are most effective for assessing KCNV1 variant effects on channel function?

For comprehensive assessment of KCNV1 variants, a multi-modal approach is recommended:

Electrophysiological assessment:

  • Whole-cell patch clamp recording to measure:

    • Voltage dependence of activation (V₁/₂)

    • Activation kinetics (τ act)

    • Deactivation kinetics (τ deact)

    • Current amplitude

    • Conductance-voltage relationships

  • Classification system based on functional alterations:

    • Class I: Variants causing instability/misfolding

    • Class II-V: Variants affecting voltage dependence, gating kinetics, or channel regulation

    • Class VI: Variants with normal function (benign)

Trafficking analysis:

  • Fluorescence microscopy with tagged constructs

  • Surface biotinylation assays

  • ELISA-based surface expression quantification

In silico prediction:
Current pathogenicity prediction tools show varying accuracy for ion channel variants. Based on benchmarking studies with KCNQ family proteins:

Note: Prediction accuracy strongly correlates with the degree of sequence conservation across paralogs. Variants affecting voltage dependence or gating kinetics are predicted with less accuracy than those causing protein instability.

How do KCNV1 mutations influence its interaction with other potassium channel subunits?

KCNV1 mutations can alter channel interactions through several mechanisms:

  • Interface disruption: Mutations at subunit interfaces may prevent proper assembly with target channels (KCNB1, KCNB2)

  • Regulatory domain alterations: Mutations in regions that modulate gating properties can affect how KCNV1 influences target channel kinetics

  • Trafficking effects: Some mutations may enhance KCNV1's ability to trap target channels in intracellular compartments, exacerbating its down-regulatory effect

Experimental approach to characterize these effects:

  • Co-expression of wild-type and mutant KCNV1 with target channels

  • Electrophysiological characterization of resulting currents

  • Fluorescence resonance energy transfer (FRET) to measure physical interactions

  • Subcellular localization studies using confocal microscopy

What are the optimal storage and handling conditions for recombinant KCNV1 protein?

Based on manufacturer recommendations for recombinant Mesocricetus auratus KCNV1:

Storage conditions:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge vial prior to opening

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration

  • Default recommendation is 50% glycerol for long-term storage

Storage buffer composition:

  • Tris/PBS-based buffer

  • 6% Trehalose

  • pH 8.0

What are the key experimental controls needed when working with recombinant KCNV1?

Essential controls for KCNV1 experiments:

  • Expression controls:

    • Empty vector transfection

    • GFP or other reporter gene to assess transfection efficiency

    • Western blot to confirm protein expression at expected molecular weight

  • Functional controls:

    • Wild-type KCNV1 as positive control

    • Co-expression with known target channels (e.g., KCNB1) to confirm modulatory function

    • Channel blockers (specific K⁺ channel inhibitors) to confirm current identity

  • Specificity controls:

    • Related potassium channel subfamily members to assess specificity of effects

    • Unrelated ion channels to rule out non-specific effects on membrane properties

  • Technical controls:

    • Multiple experimental replicates (minimum n=5 as used in similar channel studies)

    • Multiple cell passages to account for cellular variability

    • Different expression levels to assess dose-dependent effects

What are the best computational tools for predicting functional effects of KCNV1 variants?

Based on benchmarking studies with voltage-gated potassium channels, the following tools can be applied to KCNV1 variant analysis:

Performance comparison of pathogenicity prediction tools:

Important note: Prediction accuracy correlates strongly with sequence conservation. Variants in sites that are highly conserved across KCNQ paralogs are predicted with greater accuracy than variants in sites that differ among family members. Particularly challenging are variants that alter only voltage dependence of activation or gating kinetics, which show the lowest prediction accuracy.

How can contradictory experimental results in KCNV1 functional studies be reconciled?

Contradictory results are not uncommon in ion channel studies. When analyzing contradictory data from KCNV1 experiments, consider these methodological approaches:

  • Experimental condition differences:

    • Expression system variability (cell type, passage number)

    • Recording conditions (temperature, solutions, holding potentials)

    • Expression levels of KCNV1 and partner channels

  • Systematic reconciliation approach:

    • Carefully document all experimental parameters

    • Perform side-by-side comparisons under identical conditions

    • Consider concentration-dependent effects

    • Test in multiple expression systems

  • Data interpretation framework:
    Studies on voltage-gated potassium channels indicate that some variants can produce conflicting results in different experimental settings. In a comprehensive dataset of 959 electrophysiological experiments, 22 experiments showed conflicting evidence where contradicting functional effects for the same variant were described in independent publications.

  • Resolution strategies:

    • Consensus-based discussion involving multiple expert electrophysiologists

    • Mixed or unclear functional effects should be clearly documented

    • Multi-modal approach combining electrophysiology, trafficking studies, and computational predictions

  • Reporting guidelines:

    • For unresolved contradictions, report all experimental outcomes

    • Document differences in methodologies that may explain discrepancies

    • Consider both gain-of-function and loss-of-function effects, as some variants may show both depending on the functional parameter measured

How can recombinant KCNV1 be used in neurological disease models?

KCNV1 and related voltage-gated potassium channels are associated with neurological disorders including epilepsy, ataxia, and intellectual disability . Disease modeling approaches include:

  • In vitro disease modeling:

    • Expression of disease-associated variants in cell lines

    • Electrophysiological characterization to determine gain- or loss-of-function

    • Trafficking studies to assess surface expression

  • Animal models:

    • Generate transgenic models expressing KCNV1 variants

    • C57BL/6J mouse model has been used successfully for other ion channel studies

    • Perform behavioral and electrophysiological assessments

  • Patient-derived models:

    • Generate induced pluripotent stem cells (iPSCs) from patients with KCNV1 variants

    • Differentiate into neurons for functional studies

    • Compare with isogenic controls where the variant has been corrected

What is the current understanding of structure-function relationships in KCNV1?

Understanding of KCNV1 structure-function relationships is evolving:

  • Functional domains:

    • Transmembrane segments form the voltage-sensing domain

    • Pore region influences ion selectivity

    • N- and C-terminal domains mediate interactions with other channel subunits

  • Variant classification framework:
    Based on studies of related channels, variants can be classified by mechanism:

    • Class I: Misfolding-induced mistrafficking (typically in highly conserved regions)

    • Class II: Altered voltage dependence of activation

    • Class III: Changed activation kinetics

    • Class IV: Modified deactivation kinetics

    • Class V: Dysregulated channel function

    • Class VI: Normal function (benign)

  • Structure-function correlation:

    • Variants in highly conserved sites across KCNQ family members often cause misfolding

    • Variants affecting voltage dependence or gating kinetics occur at sites with lower conservation among paralogs

    • These structure-function relationships are critical for understanding both normal physiology and pathological conditions

What are emerging techniques for studying KCNV1 interactions and dynamics?

Several cutting-edge approaches are being applied to voltage-gated potassium channels:

  • Cryo-electron microscopy:

    • Allows visualization of channel structure at near-atomic resolution

    • Can capture different conformational states

    • Helpful for understanding how mutations impact structure

  • Integrative computational modeling:

    • Molecular dynamics simulations to study conformational changes

    • Machine learning approaches for variant effect prediction

    • As algorithms evolve, they may better predict effects of challenging variants

  • Advanced electrophysiology:

    • Automated patch-clamp for high-throughput screening

    • Dynamic clamp to study channel behavior in complex cellular environments

    • Combined imaging and electrophysiology to correlate structure and function

  • Gene editing technologies:

    • CRISPR-Cas9 for generating precise mutations

    • Base editors for studying specific variants

    • In vivo editing to study functional effects in native contexts

How can inconsistencies between in silico predictions and experimental results for KCNV1 variants be addressed?

The gap between computational predictions and experimental outcomes represents a significant challenge:

  • Current limitations:

    • Variants with abnormal voltage dependence or gating kinetics are predicted poorly by existing tools

    • Performance correlates with residue conservation across paralogs

    • Sites that contribute to the unique functional properties of KCNV1 are not adequately captured by current prediction methods

  • Improvement strategies:

    • Develop channel-specific prediction tools trained on experimental data

    • Incorporate electrophysiological parameters into prediction algorithms

    • Use ensemble approaches that combine multiple prediction methods

    • Create mechanistic models that account for specific functional categories

  • Integrated approach:

    • Combine computational predictions with experimental validation

    • Develop standardized frameworks for variant classification

    • Create open-access databases of experimental results to improve machine learning algorithms

  • Research priorities:

    • Focus on understanding the structural basis of channel gating

    • Investigate regions that modulate channel kinetics

    • Develop better computational models of voltage-sensing and ion permeation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.