Recombinant Mesocricetus auratus Substance-K receptor (TACR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TACR2; TAC2R; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Mesocricetus auratus (Golden hamster)
Target Names
Target Protein Sequence
MGGRAIVTDTNIFSGLESNTTGVTAFSMPAWQLALWATAYLGLVLVAVTGNATVIWIILA HERMRTVTNYFIINLALADLCMAAFNATFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPITKATIAGIWLVALALASPQCFYSTITVDQGATK CVVAWPNDNGGKMLLLYHLVVFVLVYFLPLVVMFVAYSVIGLTLWKRAVPRHQAHGANLR HLHAKKKFVKAMVLVVLTFAICWLPYHLYFILGSFQKDIYYRKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDRLELTRTPSLSRRVNRCHTKETLFMT ADMTHSEATNGQVGSPQDVEPAAP
Uniprot No.

Target Background

Function
This protein is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance K > neuromedin-K > substance P.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does TACR2 compare structurally and functionally between different species?

TACR2 exhibits evolutionary conservation across species with important structural and functional similarities. The Mesocricetus auratus (golden hamster) TACR2 functions similarly to its human ortholog as a G protein-coupled receptor with substance K receptor activity . In zebrafish, tacr2 is predicted to be involved in positive regulation of flagellated sperm motility and to act within G protein-coupled receptor signaling pathways .

Human TACR2 has been implicated in asthma, suggesting a role in inflammatory and respiratory processes . The receptor's structure maintains the characteristic 7 transmembrane domains across species, reflecting its conserved function in neurokinin signaling pathways . Additionally, the golden hamster TACR2 (376 amino acids) and human TACR2 (384 amino acids) share high sequence homology, particularly in the transmembrane and ligand-binding domains, allowing for comparative studies between species .

What are the optimal conditions for expressing recombinant TACR2 protein in E. coli?

For optimal expression of recombinant TACR2 in E. coli, researchers should consider the following methodological approach:

  • Vector selection: Use an expression vector with an N-terminal His-tag to facilitate purification while preserving receptor functionality .

  • Expression strain: BL21(DE3) or Rosetta-gami strains are recommended for membrane proteins like TACR2 to ensure proper folding.

  • Culture conditions: Initially grow cultures at 37°C until OD600 reaches 0.6-0.8, then induce with a reduced IPTG concentration (0.1-0.5 mM) at a lower temperature (16-20°C) for 16-20 hours to enhance soluble protein yield.

  • Media supplementation: Enrich media with glucose (0.5-1%) to suppress basal expression and include appropriate antibiotics for plasmid maintenance.

  • Buffer optimization: Use Tris/PBS-based buffers (pH 8.0) containing glycerol (6-50%) and trehalose (6%) as stabilizing agents to maintain protein integrity during expression and purification .

This approach accounts for the challenges of expressing membrane proteins while maximizing yield and functionality of the recombinant TACR2.

What are the most effective purification strategies for obtaining high-purity recombinant TACR2?

Achieving high-purity recombinant TACR2 requires a multi-step purification strategy:

  • Extraction preparation: Harvest cells and generate lysates using sonication or high-pressure homogenization in Tris/PBS-based buffer (pH 8.0) containing protease inhibitors and 6% trehalose .

  • Initial purification: Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA columns to capture the His-tagged TACR2 protein, with stepwise imidazole gradient elution to minimize contaminants.

  • Secondary purification: Apply size-exclusion chromatography to remove protein aggregates and achieve >90% purity as verified by SDS-PAGE .

  • Quality assessment: Conduct SDS-PAGE analysis to confirm purity exceeding 90% before proceeding to functional studies .

  • Concentration and storage: Lyophilize the purified protein or store in Tris/PBS buffer with 6% trehalose at -20°C/-80°C. For working stocks, reconstitute to 0.1-1.0 mg/mL in deionized sterile water and add glycerol (final concentration 5-50%) to prevent freezing damage during long-term storage .

This protocol ensures high purity while maintaining the structural integrity necessary for downstream applications.

How can researchers effectively measure TACR2 binding activity with its ligands?

To effectively measure TACR2 binding activity with its ligands, researchers should implement the following methodological approaches:

  • Radioligand binding assays: Use radiolabeled tachykinin peptides (particularly substance K/neurokinin A) to determine binding affinity (Kd) and receptor density (Bmax) through saturation binding experiments.

  • Competitive binding assays: Employ selective ligands such as GR-64349 (agonist, EC50 3.7nM) or antagonists like MEN-10376 to generate competition curves against a fixed concentration of radiolabeled reference ligand .

  • Fluorescence-based assays: Implement fluorescence polarization or FRET-based techniques using fluorescently labeled ligands to monitor binding kinetics in real-time.

  • Surface plasmon resonance: Immobilize purified TACR2 on sensor chips and measure binding kinetics (kon, koff) and affinity constants for various ligands including peptide and non-peptide compounds.

  • Cellular functional assays: In transfected cell systems, measure downstream signaling events such as calcium mobilization, IP3 formation, or cAMP modulation to assess functional activity of receptor-ligand interactions.

This comprehensive approach provides both direct binding parameters and functional readouts to characterize TACR2-ligand interactions fully.

What experimental models are most suitable for studying TACR2 function in physiological contexts?

Multiple experimental models provide complementary insights for studying TACR2 function in physiological contexts:

  • Recombinant cell systems: HEK293 or CHO cells transfected with TACR2 allow controlled expression and signaling studies, particularly useful for pharmacological characterization .

  • Zebrafish models: Zebrafish tacr2 studies provide insights into evolutionary conservation of function, particularly in relation to sperm motility and membrane signaling processes .

  • Hamster models: As the natural host of the studied TACR2 variant, golden hamsters (Mesocricetus auratus) represent the most physiologically relevant model for tissue-specific expression and function studies .

  • Human tissue studies: For translational relevance, human airway smooth muscle cells and bronchial epithelial cells are valuable models given TACR2's implication in asthma pathophysiology .

  • Ex vivo tissue preparations: Isolated tissue preparations (e.g., tracheal rings, intestinal segments) from hamsters can be used to study contractile responses mediated by TACR2 activation, providing a bridge between cellular and in vivo studies.

Each model offers unique advantages, with selection depending on whether the research question focuses on molecular pharmacology, signaling mechanisms, or physiological responses in relevant tissues.

How can structural modifications of TACR2 be utilized to investigate structure-function relationships?

Advanced structure-function investigations of TACR2 can be approached through several strategic modifications:

  • Site-directed mutagenesis: Systematic mutation of key residues, particularly in the transmembrane domains and ligand-binding pocket, can identify critical amino acids for ligand binding and G-protein coupling. Target residues in transmembrane regions highlighted in the sequence data (amino acids 30-90) are prime candidates .

  • Chimeric receptors: Create chimeric constructs between TACR2 and related tachykinin receptors (NK1, NK3) to map domains responsible for ligand selectivity and signaling pathway preference.

  • Truncation variants: Generate N- and C-terminal truncations to assess the role of these domains in receptor trafficking, internalization, and desensitization.

  • Fluorescent protein fusions: Develop C-terminal GFP or split-fluorescent protein constructs while preserving the critical N-terminal domain to visualize receptor localization and trafficking in real-time.

  • Cysteine accessibility methods: Introduce cysteine residues at strategic positions followed by selective labeling to probe conformational changes upon activation.

These approaches, combined with functional assays measuring ligand binding, G-protein activation, and downstream signaling, provide comprehensive insights into TACR2 structure-function relationships at the molecular level.

What are the challenges in developing selective modulators for TACR2 and how might they be overcome?

Development of selective TACR2 modulators faces several significant challenges that can be addressed through systematic approaches:

  • Receptor subtype selectivity: Achieving selectivity for TACR2 over closely related NK1 and NK3 receptors remains challenging. This can be addressed by:

    • Utilizing structural differences in the binding pocket across receptor subtypes

    • Focusing on allosteric sites rather than the orthosteric binding site

    • Screening against all three receptor subtypes simultaneously to identify selective compounds early

  • Peptide stability limitations: Peptide-based modulators like GR-64349 and MEN-10376 face pharmacokinetic limitations . Solutions include:

    • Developing peptidomimetics that maintain the key pharmacophore while improving stability

    • Exploring non-peptide scaffolds based on successful antagonists like Saredutant or Ibodutant

    • Implementing backbone modifications such as N-methylation or introducing non-natural amino acids

  • Species differences: Addressing variations between hamster and human TACR2 for translational relevance by:

    • Conducting comparative pharmacology studies across species homologs

    • Creating humanized variants in model systems

    • Developing dual-specific compounds that maintain activity across species

  • Clinical translation challenges: Previous clinical candidates like Saredutant and Ibodutant failed in advanced trials . Improving outcomes requires:

    • Better understanding of tissue-specific signaling profiles

    • Development of biased ligands that selectively activate beneficial pathways

    • Identifying patient subpopulations most likely to respond to TACR2 modulation

These strategies provide a roadmap for overcoming the historical challenges in TACR2 drug discovery.

What procedures ensure optimal stability and activity of recombinant TACR2 during experimental manipulations?

Ensuring optimal stability and activity of recombinant TACR2 requires careful handling throughout experimental procedures:

  • Reconstitution protocol: Reconstitute lyophilized TACR2 in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol to a final concentration of 5-50% to prevent freeze-thaw damage .

  • Storage conditions: Store the protein at -20°C/-80°C in small aliquots to avoid repeated freeze-thaw cycles. For working stocks, maintain at 4°C for no longer than one week .

  • Buffer optimization: Utilize Tris/PBS-based buffers at pH 8.0 containing 6% trehalose as a stabilizing agent to maintain proper protein folding and prevent aggregation .

  • Temperature management: Handle the protein at 4°C whenever possible during experimental procedures, and avoid prolonged exposure to room temperature.

  • Centrifugation step: Briefly centrifuge vials prior to opening to bring contents to the bottom and reduce protein loss .

  • Additive screening: For challenging applications, screen additives such as non-ionic detergents (0.01-0.1% Triton X-100 or NP-40), reducing agents (1-5 mM DTT or 2-ME), or carrier proteins (0.1-0.5% BSA) to enhance stability in specific experimental conditions.

Adherence to these methodological considerations maximizes protein integrity and ensures reproducible experimental outcomes when working with this sensitive membrane protein.

What are the most reliable methods for quantifying and validating TACR2 expression in different experimental systems?

Comprehensive quantification and validation of TACR2 expression across experimental systems requires multiple complementary approaches:

  • Protein quantification methods:

    • Western blotting using anti-His tag antibodies for recombinant protein or TACR2-specific antibodies for endogenous expression

    • ELISA-based quantification with calibrated standards

    • SDS-PAGE with densitometric analysis against protein standards of known concentration

  • Functional validation assays:

    • Radioligand binding assays with selective ligands to determine Bmax as a measure of functional receptor density

    • Calcium mobilization assays using fluorescent indicators to confirm receptor coupling to signaling pathways

    • GTPγS binding assays to verify G-protein coupling capacity

  • Localization confirmation:

    • Immunofluorescence microscopy to visualize membrane localization in cellular systems

    • Cell surface biotinylation to specifically quantify receptors expressed at the plasma membrane

    • Subcellular fractionation followed by immunoblotting to assess distribution between membrane and intracellular compartments

  • mRNA quantification:

    • RT-qPCR for relative or absolute quantification of TACR2 transcript levels

    • RNA-Seq for comprehensive transcriptomic analysis in more complex systems

    • In situ hybridization for spatial expression analysis in tissue samples

  • Quality control metrics:

    • Purity assessment via SDS-PAGE (>90% purity standard)

    • Thermal stability assays to confirm proper protein folding

    • Size-exclusion chromatography to verify monodispersity and absence of aggregation

This multi-parameter approach ensures accurate quantification and functional validation across diverse experimental platforms ranging from purified protein systems to complex cellular models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.