Recombinant Mesoplasma florum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
atpF; Mfl111; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) (Acholeplasma florum)
Target Names
atpF
Target Protein Sequence
MIFFAETQTAGVPEIITSLFPNLPNFIAHVIATIVLVVILSKLMYKPFRKTIKDRRNKIN ELLSEAVQKQTEANIGVRKAEALLQDAKTESSLIIQTSKVDADIQKTHIISEAHKYADII KNQAEKDIAQERSKIEAEIKTTIVNVAFDAAEQILQTEINKTKNKKIVDEFIENLDK
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembraneous catalytic core, and the F0 domain, encompassing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.
Database Links

KEGG: mfl:Mfl111

STRING: 265311.Mfl111

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of subunit b (atpF) in the F-type ATP synthase complex of Mesoplasma florum?

Subunit b (atpF) is a critical component of the F0 sector of F-type ATP synthase in Mesoplasma florum. It functions as part of the peripheral stalk (stator) that connects the membrane-embedded F0 sector to the catalytic F1 sector. The peripheral stalk prevents rotation of specific subunits while allowing others to rotate, which is essential for the enzyme's rotary catalysis mechanism. In minimal organisms like M. florum, which has evolved a streamlined genome, the F1F0 ATPase primarily functions in ATP hydrolysis and maintenance of the electrochemical gradient rather than ATP synthesis . Unlike in some bacteria where subunit b forms homodimers, the exact stoichiometry and arrangement in M. florum requires further investigation.

What expression systems are most effective for producing recombinant M. florum atpF protein?

For recombinant expression of M. florum atpF, several systems can be considered, each with distinct advantages:

Expression SystemAdvantagesChallengesOptimal Use Case
E. coliHigh yield, rapid growth, simple cultivationPotential for inclusion bodies, lack of post-translational modificationsInitial structural studies, antibody production
Insect cellsBetter membrane protein foldingMore complex, slower, expensiveFull functional studies requiring proper membrane integration
Cell-free systemsAvoids toxicity issues, rapidLower yields, expensiveDifficult-to-express constructs, incorporation of modified amino acids

For methodology, start with codon-optimized constructs in E. coli using vectors that provide N- or C-terminal fusion tags (His6, MBP, or SUMO) to enhance solubility and facilitate purification. For membrane-integrated studies, consider using pBAD or pET vectors with mild induction conditions (lower temperatures of 16-20°C and reduced inducer concentrations). The choice between detergent solubilization and nanodisc/liposome reconstitution depends on downstream applications.

How can researchers overcome the challenges of expressing membrane components of the ATP synthase complex?

Expression of membrane proteins like atpF presents specific challenges. Methodological solutions include:

  • Use specialized E. coli strains (C41(DE3), C43(DE3), or Lemo21(DE3)) engineered for membrane protein expression

  • Employ fusion partners that enhance membrane integration (Mistic, YidC, or SUMO)

  • Optimize growth conditions using a DOE (Design of Experiments) approach with variables including:

    • Temperature (typically lowered to 16-20°C post-induction)

    • Media composition (supplemented with glycerol and specific ions)

    • Inducer concentration (typically reduced to minimize toxicity)

For solubilization, perform detergent screening with a panel including DDM, LMNG, and digitonin. Stability can be assessed using nanoDSF or CPM thermal shift assays. For improved stability, co-expression with other F0 subunits may preserve native interactions and enhance proper folding. This approach may be particularly valuable given the specialized membrane environment of M. florum as a wall-less bacterium .

What are the most appropriate techniques for determining the structure of recombinant M. florum atpF protein?

A multi-technique approach is recommended for structural characterization:

  • Cryo-EM Analysis: The gold standard for ATP synthase complexes, particularly if atpF can be reconstituted with other subunits. Resolution of 2.5-3.5 Å is achievable for well-behaved samples.

  • X-ray Crystallography: Challenging for full-length membrane proteins but suitable for soluble domains. Consider limited proteolysis to identify stable domains.

  • Solution NMR: Appropriate for smaller fragments (up to ~25 kDa) to obtain dynamic information.

  • Cross-linking Mass Spectrometry (XL-MS): Provides valuable constraint data on protein-protein interactions within the complex.

  • Hydrogen-Deuterium Exchange MS (HDX-MS): Maps solvent accessibility and conformational dynamics.

For preliminary studies, circular dichroism spectroscopy provides secondary structure content while SAXS can yield low-resolution envelopes of soluble domains. Functional analysis should accompany structural studies through ATPase activity assays of reconstituted proteoliposomes, as demonstrated with other ATP synthase systems .

How can researchers assess the functional activity of recombinant M. florum atpF in experimental systems?

Functional characterization requires assessment at both the individual protein and complex levels:

  • Binding Assays: Assess interaction with other ATP synthase subunits using:

    • Microscale thermophoresis (MST)

    • Bio-layer interferometry (BLI)

    • Isothermal titration calorimetry (ITC)

  • Complex Assembly: Evaluate incorporation into larger assemblies via:

    • Blue native PAGE

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation (AUC)

  • Functional Reconstitution: For whole-complex activity:

    • Reconstitute with other purified subunits into liposomes

    • Measure proton translocation using pH-sensitive fluorescent dyes

    • Assess ATP hydrolysis/synthesis with coupled enzymatic assays

These methods can be calibrated using established ATP hydrolysis measurement protocols, similar to those used for other mycoplasma ATP synthases where colorimetric assays measured phosphate release from ATP . Given M. florum's metabolic capabilities, correlating ATPase activity with lactate/acetate production pathways may provide insights into energy coupling mechanisms .

What experimental approaches can distinguish between ATP synthase and ATPase functions in M. florum atpF-containing complexes?

This distinction is particularly important for M. florum, which likely uses its F-type complex primarily as an ATPase rather than ATP synthase . Methodological approaches include:

  • Directional Assays in Proteoliposomes:

    • Create an artificial proton gradient and measure ATP production (synthase activity)

    • Add ATP and measure proton pumping (ATPase activity)

    • Compare rates in both directions to determine physiological preference

  • Inhibitor Studies:

    • Differential sensitivity to inhibitors (oligomycin, DCCD, and venturicidin affect different aspects of the complex)

    • Measure effects on proton translocation versus ATP hydrolysis/synthesis

  • Site-Directed Mutagenesis:

    • Introduce mutations in key residues of atpF predicted to affect stator function

    • Assess impact on directionality of the enzyme

Results should be analyzed in the context of M. florum's metabolic network, particularly its relationships with lactate and acetate production pathways that generate ATP through substrate-level phosphorylation .

How has the atpF gene evolved in minimal bacterial genomes like M. florum compared to other bacteria?

Evolutionary analysis of atpF in minimal genomes reveals distinctive patterns:

  • Sequence Conservation vs. Structural Conservation: Despite significant sequence divergence, structural features critical for function are maintained. This pattern is similar to what has been observed in apicomplexan organisms, where ATP synthase subunits show extreme sequence diversification while maintaining essential structural features .

  • Comparative Analysis Framework:

    • Compare sequence conservation across mollicutes, focusing on membrane-spanning regions versus peripheral regions

    • Analyze selection pressures using dN/dS ratios across different domains of the protein

    • Identify co-evolving residues between atpF and interacting subunits

  • Genomic Context Conservation:

    • Analyze operon structure and gene synteny across related species

    • Identify potential regulatory elements affecting expression

Unlike the situation in some mycoplasmas where duplicate copies of ATP synthase components (e.g., atpA and atpD) have been identified , M. florum appears to maintain a streamlined ATP synthase complex consistent with its minimal genome philosophy. This suggests strong selective pressure to maintain core energetic functions even in a genome-reduced organism.

What insights can be gained from studying atpF in minimal organisms for understanding ATP synthase evolution?

M. florum's atpF provides a unique window into evolutionary processes:

  • Minimal Functional Requirements: Identifying conserved elements in M. florum atpF helps define the absolute minimal requirements for ATP synthase function, informative for both evolutionary studies and synthetic biology applications.

  • Adaptation to Specialized Niches: Analyze how atpF has adapted to M. florum's lifestyle, particularly:

    • Host association adaptations

    • Energy limitation adaptations

    • Membrane composition differences

  • Methodological Approach for Evolutionary Analysis:

    • Construct phylogenetic trees using both whole-sequence and domain-specific alignments

    • Perform ancestral sequence reconstruction to track evolutionary trajectories

    • Use structural modeling to map sequence changes onto predicted structural features

This research connects to broader questions about the evolution of bioenergetic systems and the minimum genetic requirements for cellular life, particularly relevant to synthetic biology efforts aiming to create minimal cells .

How can recombinant M. florum atpF be utilized in minimal cell or synthetic biology applications?

M. florum's atpF has significant potential in synthetic biology applications:

  • Minimal Cell Design:

    • As a component for engineered minimal ATP synthase complexes

    • For testing the minimum requirements for cellular bioenergetics

    • In the design of modular bioenergetic systems

  • Methodological Approaches:

    • Develop orthogonal ATP production systems in engineered organisms

    • Create chimeric ATP synthases with components from different organisms

    • Design simplified ATP synthase variants for specific applications

  • Experimental Design Considerations:

    • Optimize expression with synthetic biology tools (inducible promoters, RBS optimization)

    • Test function in heterologous hosts including both bacteria and cell-free systems

    • Develop high-throughput assays for ATP synthase function in engineered systems

Given M. florum's position as a fast-growing near-minimal organism, its ATP synthase components present valuable parts for the design of simplified cellular systems. The ability to test these components in different contexts could provide fundamental insights into the principles governing cellular energetics .

What potential challenges might researchers face when incorporating M. florum atpF into engineered biological systems?

Several technical challenges require consideration:

  • Compatibility Issues:

    • Potential incompatibility with ATP synthase components from other organisms

    • Membrane integration challenges in heterologous expression systems

    • Possible requirements for specific lipid environments

  • Performance Metrics:

    • Energy efficiency compared to native ATP synthases

    • Stability and operational lifetime in engineered systems

    • Response to different environmental conditions

  • Methodological Solutions:

    • Design fusion proteins or adaptors to enable interaction with heterologous components

    • Engineer synthetic membrane environments mimicking M. florum conditions

    • Develop directed evolution approaches to optimize performance in new contexts

Research in this area should incorporate controls comparing the engineered systems with natural ATP synthases, using standardized assays for ATP production/hydrolysis rates, proton translocation efficiency, and assembly completeness .

How can researchers troubleshoot issues with recombinant M. florum atpF expression and purification?

Common challenges and methodological solutions include:

IssueProbable CausesTroubleshooting Approach
Low expression yieldToxicity, rare codons, mRNA secondary structureUse tight expression control, codon optimization, lower temperature (16°C), test multiple fusion tags
Inclusion body formationRapid expression, improper foldingReduce inducer concentration, use solubility tags (SUMO, MBP), add chemical chaperones (trehalose, glycerol)
Poor membrane integrationHydrophobic mismatch, overexpressionUse specialized strains (C41/C43), consider lipid supplementation, co-express with other F0 components
Aggregation during purificationDetergent issues, improper buffer conditionsScreen multiple detergents, include glycerol (10-15%), optimize ionic strength, add stabilizing lipids
Low purityNon-specific binding, contaminant co-purificationImplement multi-step purification, add imidazole washes, consider on-column detergent exchange

For challenging constructs, consider screening a panel of 6-8 detergents including DDM, LMNG, and digitonin at various critical micelle concentrations. Additionally, thermostability screening using nanoDSF can identify optimal buffer conditions that maximize protein stability .

What considerations are important when designing antibodies against M. florum atpF for research applications?

Development of effective antibodies requires careful planning:

  • Epitope Selection Strategy:

    • Perform bioinformatic analysis to identify exposed, antigenic regions

    • Focus on cytoplasmic domains which are typically more immunogenic

    • Avoid highly conserved regions if specificity to M. florum is desired

  • Antibody Format Selection:

    • Polyclonal antibodies: Broader epitope recognition but lower specificity

    • Monoclonal antibodies: Higher specificity but more resource-intensive

    • Recombinant antibody fragments: Useful for specific applications like in-cell labeling

  • Validation Methods:

    • Western blotting against recombinant protein and native extracts

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence microscopy with appropriate controls

    • Cross-reactivity testing against related species

The experimental approach used for M. florum ATP synthase can follow similar strategies to those successfully employed for other mycoplasma F1F0 ATPase components, where monospecific polyclonal antibodies allowed detection of specific subunits in wild-type and mutant strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.